Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DNZ4

Protein Details
Accession C5DNZ4    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
11-31NDQIRKKHKCWHDGKLKLRSDBasic
NLS Segment(s)
PositionSequence
96-112PIGRPAKPAGPARPARR
Subcellular Location(s) nucl 15, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018838  DUF2439  
KEGG zro:ZYRO0A12892g  -  
Pfam View protein in Pfam  
PF10382  DUF2439  
Amino Acid Sequences MGGEYECQYSNDQIRKKHKCWHDGKLKLRSDGKVALCDEDGSKLSVKREMGRWLDPKKFNQEFQFCSRFVVAITSLDEKPSLALPMRPFKTPRTLPIGRPAKPAGPARPARRTKVLQLQQSQMPSRTRARIRHVQVEPIRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.62
3 0.65
4 0.7
5 0.71
6 0.73
7 0.76
8 0.77
9 0.77
10 0.77
11 0.82
12 0.82
13 0.78
14 0.75
15 0.72
16 0.63
17 0.56
18 0.53
19 0.46
20 0.41
21 0.37
22 0.32
23 0.27
24 0.26
25 0.22
26 0.17
27 0.16
28 0.13
29 0.14
30 0.14
31 0.15
32 0.18
33 0.19
34 0.2
35 0.23
36 0.28
37 0.3
38 0.35
39 0.41
40 0.43
41 0.49
42 0.5
43 0.5
44 0.53
45 0.51
46 0.48
47 0.48
48 0.47
49 0.43
50 0.45
51 0.45
52 0.36
53 0.34
54 0.31
55 0.24
56 0.19
57 0.16
58 0.1
59 0.08
60 0.09
61 0.11
62 0.1
63 0.11
64 0.11
65 0.09
66 0.09
67 0.09
68 0.09
69 0.07
70 0.1
71 0.13
72 0.22
73 0.23
74 0.25
75 0.27
76 0.28
77 0.37
78 0.36
79 0.37
80 0.37
81 0.39
82 0.39
83 0.47
84 0.52
85 0.45
86 0.48
87 0.45
88 0.39
89 0.42
90 0.45
91 0.4
92 0.41
93 0.47
94 0.49
95 0.57
96 0.6
97 0.59
98 0.62
99 0.61
100 0.6
101 0.63
102 0.64
103 0.62
104 0.62
105 0.61
106 0.57
107 0.59
108 0.55
109 0.49
110 0.44
111 0.41
112 0.42
113 0.46
114 0.5
115 0.52
116 0.57
117 0.62
118 0.66
119 0.71
120 0.68
121 0.69