Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DS16

Protein Details
Accession C5DS16    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
194-219QDEFTTFVPRRKRKNRQAYQEPKLDYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
IPR040044  SRR1L  
KEGG zro:ZYRO0B13046g  -  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MGFSKSKRQVSHVVKKREFSEVLGEYRDEIKKSQMFKELCQSLEAYRQHIVRVRCLALGSFHEEFSAKWQLALLMELLDYLNASNPLVSVYDPVFTEEDLKFVSQLERWSVDENLSAEWNEDSSRTLFFLPHAPLDLTELVLDKEQPKYWLANHFIAHTDRYTKVQLFEKYPLISKLINSLSATGPRRDQMASQDEFTTFVPRRKRKNRQAYQEPKLDYSRINSKFQKCELLQDFQQGDLLRNQPWVNSFSDLALHLID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.7
4 0.67
5 0.58
6 0.49
7 0.48
8 0.41
9 0.39
10 0.36
11 0.34
12 0.29
13 0.33
14 0.33
15 0.26
16 0.23
17 0.28
18 0.31
19 0.35
20 0.38
21 0.41
22 0.4
23 0.42
24 0.5
25 0.46
26 0.42
27 0.39
28 0.35
29 0.28
30 0.35
31 0.33
32 0.26
33 0.26
34 0.26
35 0.28
36 0.32
37 0.32
38 0.3
39 0.33
40 0.32
41 0.29
42 0.29
43 0.26
44 0.23
45 0.24
46 0.24
47 0.2
48 0.18
49 0.18
50 0.18
51 0.17
52 0.2
53 0.23
54 0.16
55 0.15
56 0.16
57 0.16
58 0.16
59 0.16
60 0.11
61 0.06
62 0.06
63 0.06
64 0.06
65 0.05
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.06
76 0.07
77 0.07
78 0.08
79 0.08
80 0.1
81 0.09
82 0.09
83 0.12
84 0.11
85 0.11
86 0.11
87 0.11
88 0.09
89 0.09
90 0.1
91 0.09
92 0.1
93 0.11
94 0.12
95 0.13
96 0.15
97 0.15
98 0.14
99 0.14
100 0.13
101 0.12
102 0.11
103 0.1
104 0.08
105 0.08
106 0.08
107 0.06
108 0.06
109 0.07
110 0.07
111 0.07
112 0.07
113 0.08
114 0.07
115 0.08
116 0.12
117 0.12
118 0.11
119 0.12
120 0.11
121 0.11
122 0.13
123 0.12
124 0.08
125 0.07
126 0.07
127 0.07
128 0.07
129 0.08
130 0.07
131 0.09
132 0.09
133 0.1
134 0.11
135 0.13
136 0.15
137 0.21
138 0.24
139 0.26
140 0.25
141 0.25
142 0.26
143 0.26
144 0.24
145 0.19
146 0.18
147 0.15
148 0.17
149 0.19
150 0.18
151 0.2
152 0.26
153 0.28
154 0.28
155 0.31
156 0.31
157 0.3
158 0.3
159 0.28
160 0.24
161 0.21
162 0.18
163 0.21
164 0.19
165 0.19
166 0.18
167 0.19
168 0.18
169 0.24
170 0.26
171 0.22
172 0.22
173 0.21
174 0.23
175 0.21
176 0.22
177 0.22
178 0.26
179 0.26
180 0.26
181 0.27
182 0.25
183 0.26
184 0.25
185 0.25
186 0.2
187 0.24
188 0.33
189 0.39
190 0.5
191 0.6
192 0.7
193 0.75
194 0.84
195 0.88
196 0.89
197 0.93
198 0.92
199 0.89
200 0.86
201 0.78
202 0.7
203 0.63
204 0.54
205 0.45
206 0.4
207 0.43
208 0.39
209 0.44
210 0.48
211 0.53
212 0.57
213 0.58
214 0.62
215 0.52
216 0.58
217 0.54
218 0.53
219 0.47
220 0.48
221 0.46
222 0.37
223 0.4
224 0.31
225 0.28
226 0.27
227 0.28
228 0.21
229 0.25
230 0.25
231 0.24
232 0.26
233 0.26
234 0.24
235 0.25
236 0.24
237 0.2
238 0.22
239 0.21