Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5E3U6

Protein Details
Accession C5E3U6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSNKKQSKSKASESHKRGGRHydrophilic
NLS Segment(s)
PositionSequence
16-16K
Subcellular Location(s) plas 18, nucl 6.5, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG zro:ZYRO0E00308g  -  
Amino Acid Sequences MSNKKQSKSKASESHKRGGRENSPRGQHNSPSPQRNNSITDQQGSENGGTGSRTYGIKLAARLFRNPLLSKRGVKHAKEGLKIRSSDKSISGVRCGGSFCLFVYPIFLIGYSIFGFLYGDKNNSIHVFLYGSPLFTAVPYIIQYLNDVDTLLLSIFEIGEKNLLEYFADPGIRELLLIVFEIVGFIYQLVKGRQNFGIFICGIVGFVSYLLGHTLLILERKKRPGSVAGDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.72
4 0.68
5 0.67
6 0.67
7 0.67
8 0.7
9 0.69
10 0.69
11 0.71
12 0.71
13 0.67
14 0.63
15 0.62
16 0.64
17 0.64
18 0.67
19 0.67
20 0.66
21 0.67
22 0.65
23 0.61
24 0.55
25 0.54
26 0.47
27 0.44
28 0.39
29 0.35
30 0.32
31 0.29
32 0.24
33 0.18
34 0.15
35 0.13
36 0.11
37 0.11
38 0.1
39 0.1
40 0.1
41 0.1
42 0.11
43 0.13
44 0.15
45 0.17
46 0.22
47 0.26
48 0.28
49 0.29
50 0.31
51 0.32
52 0.35
53 0.35
54 0.33
55 0.34
56 0.36
57 0.39
58 0.39
59 0.46
60 0.48
61 0.47
62 0.5
63 0.51
64 0.52
65 0.53
66 0.56
67 0.51
68 0.49
69 0.49
70 0.45
71 0.42
72 0.39
73 0.34
74 0.3
75 0.29
76 0.28
77 0.28
78 0.27
79 0.23
80 0.21
81 0.2
82 0.19
83 0.15
84 0.12
85 0.11
86 0.09
87 0.09
88 0.09
89 0.08
90 0.09
91 0.08
92 0.08
93 0.07
94 0.07
95 0.06
96 0.05
97 0.07
98 0.05
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.08
105 0.07
106 0.08
107 0.08
108 0.08
109 0.09
110 0.1
111 0.1
112 0.08
113 0.08
114 0.08
115 0.08
116 0.12
117 0.11
118 0.11
119 0.1
120 0.1
121 0.1
122 0.08
123 0.09
124 0.04
125 0.05
126 0.05
127 0.07
128 0.06
129 0.07
130 0.07
131 0.08
132 0.08
133 0.08
134 0.07
135 0.06
136 0.06
137 0.06
138 0.05
139 0.04
140 0.03
141 0.03
142 0.03
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.06
149 0.07
150 0.07
151 0.07
152 0.07
153 0.09
154 0.09
155 0.09
156 0.09
157 0.09
158 0.1
159 0.1
160 0.09
161 0.08
162 0.06
163 0.06
164 0.07
165 0.06
166 0.04
167 0.04
168 0.05
169 0.04
170 0.04
171 0.03
172 0.03
173 0.04
174 0.05
175 0.08
176 0.11
177 0.17
178 0.18
179 0.22
180 0.25
181 0.26
182 0.26
183 0.25
184 0.27
185 0.2
186 0.2
187 0.17
188 0.13
189 0.12
190 0.1
191 0.09
192 0.05
193 0.05
194 0.06
195 0.05
196 0.05
197 0.06
198 0.06
199 0.06
200 0.05
201 0.07
202 0.08
203 0.14
204 0.18
205 0.23
206 0.3
207 0.38
208 0.41
209 0.42
210 0.45
211 0.48
212 0.5