Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DVQ7

Protein Details
Accession C5DVQ7   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
8-28CLSALSKRTKRVKVQILKDFPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 13.165, nucl 9, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036935  Ribosomal_L9_N_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG zro:ZYRO0D08646g  -  
Amino Acid Sequences MFKPTSICLSALSKRTKRVKVQILKDFPQFLLYRGEVAQVKPSLMRNYLHNYNGARYILQDNDIDLELMKSFEQRQEELRSAKSESKTKEDAVHTADTTPDKSSTQSPAQTTAPQSQQQEPEKPKGVLEKDITVKDIKIPGLDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.6
3 0.65
4 0.67
5 0.72
6 0.75
7 0.75
8 0.8
9 0.82
10 0.8
11 0.76
12 0.71
13 0.63
14 0.52
15 0.48
16 0.38
17 0.29
18 0.27
19 0.23
20 0.21
21 0.19
22 0.23
23 0.19
24 0.19
25 0.23
26 0.18
27 0.18
28 0.19
29 0.22
30 0.21
31 0.22
32 0.23
33 0.21
34 0.27
35 0.31
36 0.3
37 0.3
38 0.28
39 0.27
40 0.29
41 0.25
42 0.19
43 0.16
44 0.17
45 0.14
46 0.15
47 0.13
48 0.1
49 0.11
50 0.11
51 0.09
52 0.07
53 0.07
54 0.05
55 0.06
56 0.05
57 0.05
58 0.06
59 0.08
60 0.1
61 0.11
62 0.14
63 0.18
64 0.21
65 0.22
66 0.23
67 0.23
68 0.24
69 0.27
70 0.28
71 0.29
72 0.29
73 0.33
74 0.34
75 0.33
76 0.36
77 0.33
78 0.32
79 0.3
80 0.29
81 0.24
82 0.22
83 0.22
84 0.18
85 0.17
86 0.16
87 0.14
88 0.13
89 0.14
90 0.16
91 0.2
92 0.24
93 0.27
94 0.27
95 0.29
96 0.31
97 0.32
98 0.33
99 0.33
100 0.33
101 0.34
102 0.36
103 0.37
104 0.43
105 0.46
106 0.51
107 0.51
108 0.54
109 0.54
110 0.51
111 0.49
112 0.49
113 0.47
114 0.45
115 0.43
116 0.42
117 0.43
118 0.43
119 0.43
120 0.36
121 0.34
122 0.31
123 0.31
124 0.26