Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5E1R1

Protein Details
Accession C5E1R1   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAVKSSKKNGGKKLLQSRLQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, mito_nucl 10.833, nucl 6.5, cyto_nucl 6.166, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028005  AcTrfase_ESCO_Znf_dom  
IPR016181  Acyl_CoA_acyltransferase  
IPR028009  ESCO_Acetyltransf_dom  
IPR000182  GNAT_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
GO:0046872  F:metal ion binding  
GO:0007049  P:cell cycle  
KEGG zro:ZYRO0G00638g  -  
Pfam View protein in Pfam  
PF13880  Acetyltransf_13  
PF13878  zf-C2H2_3  
PROSITE View protein in PROSITE  
PS51186  GNAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MAVKSSKKNGGKKLLQSRLQIGPTTNLTKCTKCGMTYSPSVIDDTTTHKNYHEMHLKGKKWPATWGLGISLPSSDGSTALTPPSSSSKRGISNTKAERIVMVRSDHQPEVRTTLHILDIVNDELHAPHNENEFWCRPNSNGKAFLYVKEDRAVGVITVELLKPERCRWMIYEDRSIVDGVEPRFILGVSRIWVCRTQRNKGIATKLLEAARSNTIYGKTIEKWAMAWSQPTDSGGKLASHYNGVRHKSGKLLIPCYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.75
4 0.71
5 0.67
6 0.62
7 0.54
8 0.45
9 0.4
10 0.38
11 0.4
12 0.35
13 0.34
14 0.36
15 0.35
16 0.35
17 0.38
18 0.35
19 0.3
20 0.34
21 0.33
22 0.34
23 0.36
24 0.38
25 0.34
26 0.32
27 0.31
28 0.27
29 0.23
30 0.19
31 0.21
32 0.25
33 0.24
34 0.24
35 0.24
36 0.28
37 0.29
38 0.37
39 0.4
40 0.34
41 0.42
42 0.5
43 0.52
44 0.54
45 0.58
46 0.54
47 0.46
48 0.49
49 0.44
50 0.4
51 0.39
52 0.34
53 0.29
54 0.25
55 0.25
56 0.2
57 0.15
58 0.11
59 0.1
60 0.09
61 0.07
62 0.06
63 0.07
64 0.07
65 0.08
66 0.08
67 0.08
68 0.07
69 0.09
70 0.16
71 0.16
72 0.18
73 0.2
74 0.24
75 0.29
76 0.34
77 0.38
78 0.36
79 0.44
80 0.46
81 0.49
82 0.45
83 0.39
84 0.37
85 0.32
86 0.29
87 0.22
88 0.19
89 0.17
90 0.2
91 0.23
92 0.23
93 0.23
94 0.23
95 0.2
96 0.23
97 0.21
98 0.19
99 0.16
100 0.16
101 0.15
102 0.14
103 0.13
104 0.1
105 0.1
106 0.1
107 0.09
108 0.08
109 0.07
110 0.06
111 0.08
112 0.07
113 0.07
114 0.08
115 0.1
116 0.11
117 0.11
118 0.15
119 0.15
120 0.16
121 0.15
122 0.14
123 0.14
124 0.23
125 0.26
126 0.26
127 0.29
128 0.28
129 0.34
130 0.34
131 0.35
132 0.31
133 0.29
134 0.26
135 0.23
136 0.22
137 0.16
138 0.16
139 0.14
140 0.09
141 0.07
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.08
149 0.1
150 0.12
151 0.17
152 0.17
153 0.19
154 0.21
155 0.27
156 0.34
157 0.36
158 0.41
159 0.37
160 0.37
161 0.36
162 0.34
163 0.26
164 0.2
165 0.19
166 0.13
167 0.14
168 0.13
169 0.12
170 0.12
171 0.12
172 0.11
173 0.09
174 0.1
175 0.1
176 0.12
177 0.13
178 0.14
179 0.2
180 0.22
181 0.3
182 0.35
183 0.4
184 0.46
185 0.51
186 0.54
187 0.55
188 0.59
189 0.56
190 0.53
191 0.48
192 0.45
193 0.41
194 0.37
195 0.32
196 0.28
197 0.27
198 0.24
199 0.21
200 0.2
201 0.2
202 0.2
203 0.21
204 0.22
205 0.2
206 0.25
207 0.25
208 0.23
209 0.22
210 0.23
211 0.26
212 0.23
213 0.25
214 0.21
215 0.22
216 0.23
217 0.24
218 0.22
219 0.19
220 0.19
221 0.17
222 0.16
223 0.15
224 0.18
225 0.18
226 0.22
227 0.23
228 0.29
229 0.34
230 0.38
231 0.42
232 0.41
233 0.41
234 0.42
235 0.45
236 0.46
237 0.46