Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DNW9

Protein Details
Accession C5DNW9   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-42AAMAGGKKSKKKWSKKSHKDKAQHAVIFHydrophilic
NLS Segment(s)
PositionSequence
15-35AAMAGGKKSKKKWSKKSHKDK
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG zro:ZYRO0A12254g  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKQQLSKAQKAAAAMAGGKKSKKKWSKKSHKDKAQHAVIFDQDKYDRMMKDVPSYRYVSVSVLVDRLKVGGSLARVALRHLESEGVIKPVSKHSKQAIYTRATAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.3
3 0.22
4 0.19
5 0.2
6 0.21
7 0.24
8 0.28
9 0.32
10 0.41
11 0.5
12 0.57
13 0.65
14 0.73
15 0.81
16 0.87
17 0.93
18 0.94
19 0.94
20 0.91
21 0.89
22 0.86
23 0.84
24 0.74
25 0.63
26 0.54
27 0.47
28 0.4
29 0.31
30 0.24
31 0.16
32 0.15
33 0.16
34 0.18
35 0.15
36 0.15
37 0.18
38 0.17
39 0.23
40 0.28
41 0.28
42 0.28
43 0.3
44 0.28
45 0.26
46 0.26
47 0.19
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.09
63 0.11
64 0.11
65 0.11
66 0.15
67 0.14
68 0.13
69 0.13
70 0.13
71 0.12
72 0.14
73 0.15
74 0.13
75 0.13
76 0.13
77 0.14
78 0.23
79 0.31
80 0.31
81 0.36
82 0.41
83 0.49
84 0.53
85 0.6
86 0.58
87 0.54