Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DZZ5

Protein Details
Accession C5DZZ5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-39EVSPVKRVKRLEKKPLTPTKGRBasic
NLS Segment(s)
PositionSequence
23-53KRVKRLEKKPLTPTKGRVSKPARQRTVSPRM
Subcellular Location(s) nucl 23, cyto_nucl 13.333, mito_nucl 12.833
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG zro:ZYRO0G08426g  -  
Amino Acid Sequences MSDNEKVDKTEPKDSSVEVSPVKRVKRLEKKPLTPTKGRVSKPARQRTVSPRMKAKQVALATTRNPQQQQRQNKDSFYRGALLGSFLGATLSTVITNAIAKLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.35
4 0.34
5 0.28
6 0.28
7 0.31
8 0.34
9 0.35
10 0.36
11 0.38
12 0.45
13 0.52
14 0.6
15 0.65
16 0.69
17 0.75
18 0.8
19 0.85
20 0.81
21 0.75
22 0.72
23 0.71
24 0.69
25 0.63
26 0.62
27 0.58
28 0.59
29 0.64
30 0.68
31 0.63
32 0.57
33 0.61
34 0.6
35 0.64
36 0.64
37 0.58
38 0.56
39 0.53
40 0.55
41 0.52
42 0.44
43 0.4
44 0.34
45 0.33
46 0.27
47 0.28
48 0.25
49 0.27
50 0.3
51 0.27
52 0.28
53 0.31
54 0.38
55 0.44
56 0.53
57 0.58
58 0.62
59 0.62
60 0.64
61 0.64
62 0.58
63 0.52
64 0.43
65 0.36
66 0.28
67 0.26
68 0.21
69 0.18
70 0.14
71 0.11
72 0.09
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.07