Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DSM9

Protein Details
Accession C5DSM9   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-97LARARSKQGSKILQRRKHKGRWFLTHHydrophilic
NLS Segment(s)
PositionSequence
63-92LKRKRRVGFLARARSKQGSKILQRRKHKGR
Subcellular Location(s) mito 18.5, cyto_mito 10.833, nucl 5.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG zro:ZYRO0C01540g  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MWSFARNIFQVGARRSLFTMGNWTPTTVSPLQRLLGPSPLSSGFGMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.32
4 0.28
5 0.22
6 0.27
7 0.21
8 0.26
9 0.25
10 0.25
11 0.23
12 0.22
13 0.27
14 0.22
15 0.23
16 0.21
17 0.22
18 0.22
19 0.22
20 0.24
21 0.19
22 0.21
23 0.2
24 0.17
25 0.17
26 0.17
27 0.17
28 0.15
29 0.14
30 0.1
31 0.13
32 0.15
33 0.14
34 0.21
35 0.23
36 0.26
37 0.29
38 0.33
39 0.35
40 0.42
41 0.52
42 0.52
43 0.57
44 0.56
45 0.59
46 0.59
47 0.59
48 0.6
49 0.59
50 0.59
51 0.58
52 0.67
53 0.63
54 0.66
55 0.7
56 0.69
57 0.7
58 0.71
59 0.75
60 0.71
61 0.7
62 0.66
63 0.63
64 0.56
65 0.52
66 0.51
67 0.5
68 0.54
69 0.62
70 0.69
71 0.72
72 0.8
73 0.85
74 0.86
75 0.87
76 0.86
77 0.86