Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DSX5

Protein Details
Accession C5DSX5   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
254-278PLDTRHTQAKQLRKKQHNYEFPEEWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR039848  Ribosomal_S24/S35  
IPR019349  Ribosomal_S24/S35_mit  
IPR017081  Ribosomal_S24_mit  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG zro:ZYRO0C03740g  -  
Pfam View protein in Pfam  
PF10213  MRP-S28  
Amino Acid Sequences MSFVAKRLLCSSRVLLNKPAAQVVQNTPTNLYLEPSKWKGLPTEKIFHLFRERVAKLGSRYRPCEEELDALLSTSEETGVLKRDIHKIYYNGEKGAVDIIGGSLKDNYSPTPFMFDELPSQAQDLVAQHREQRFYNRLAAYELPLLVQYRQEYKRPSRETHPVEYKFTTYIGEEHPNARKVVFKVKVGDLGLDERQRHKLCLLAKTRYDSTTDIFKMSSDRYPEASQNSRYLNDVFQRLLNESKDMSDDFSDIPLDTRHTQAKQLRKKQHNYEFPEEWKRPQDAPKPKFSFVQTLSQNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.45
4 0.48
5 0.45
6 0.44
7 0.37
8 0.33
9 0.34
10 0.33
11 0.34
12 0.33
13 0.32
14 0.31
15 0.31
16 0.31
17 0.27
18 0.24
19 0.2
20 0.19
21 0.26
22 0.28
23 0.3
24 0.29
25 0.31
26 0.35
27 0.4
28 0.47
29 0.46
30 0.49
31 0.48
32 0.53
33 0.52
34 0.49
35 0.5
36 0.41
37 0.39
38 0.42
39 0.4
40 0.36
41 0.38
42 0.38
43 0.35
44 0.44
45 0.48
46 0.46
47 0.5
48 0.51
49 0.51
50 0.49
51 0.47
52 0.4
53 0.35
54 0.29
55 0.27
56 0.23
57 0.2
58 0.18
59 0.14
60 0.12
61 0.08
62 0.07
63 0.04
64 0.05
65 0.06
66 0.09
67 0.1
68 0.12
69 0.15
70 0.22
71 0.24
72 0.26
73 0.3
74 0.29
75 0.32
76 0.39
77 0.38
78 0.31
79 0.3
80 0.27
81 0.23
82 0.21
83 0.17
84 0.08
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.06
93 0.07
94 0.08
95 0.1
96 0.12
97 0.12
98 0.16
99 0.16
100 0.17
101 0.17
102 0.16
103 0.16
104 0.17
105 0.18
106 0.13
107 0.13
108 0.12
109 0.11
110 0.11
111 0.1
112 0.11
113 0.12
114 0.12
115 0.16
116 0.18
117 0.21
118 0.21
119 0.26
120 0.26
121 0.27
122 0.32
123 0.29
124 0.27
125 0.27
126 0.27
127 0.22
128 0.19
129 0.16
130 0.1
131 0.1
132 0.1
133 0.08
134 0.09
135 0.08
136 0.14
137 0.16
138 0.19
139 0.24
140 0.3
141 0.4
142 0.43
143 0.46
144 0.45
145 0.53
146 0.54
147 0.57
148 0.59
149 0.52
150 0.51
151 0.48
152 0.44
153 0.35
154 0.3
155 0.23
156 0.14
157 0.13
158 0.13
159 0.15
160 0.15
161 0.18
162 0.22
163 0.23
164 0.23
165 0.21
166 0.22
167 0.21
168 0.29
169 0.29
170 0.28
171 0.3
172 0.3
173 0.34
174 0.3
175 0.29
176 0.2
177 0.2
178 0.2
179 0.2
180 0.2
181 0.19
182 0.26
183 0.27
184 0.27
185 0.24
186 0.26
187 0.27
188 0.34
189 0.39
190 0.37
191 0.39
192 0.43
193 0.44
194 0.41
195 0.39
196 0.32
197 0.27
198 0.29
199 0.27
200 0.23
201 0.21
202 0.2
203 0.21
204 0.21
205 0.23
206 0.2
207 0.21
208 0.24
209 0.26
210 0.29
211 0.33
212 0.36
213 0.35
214 0.36
215 0.36
216 0.33
217 0.33
218 0.31
219 0.29
220 0.28
221 0.28
222 0.24
223 0.23
224 0.24
225 0.24
226 0.27
227 0.24
228 0.22
229 0.2
230 0.19
231 0.2
232 0.18
233 0.18
234 0.15
235 0.15
236 0.14
237 0.14
238 0.14
239 0.12
240 0.13
241 0.12
242 0.15
243 0.16
244 0.19
245 0.24
246 0.25
247 0.33
248 0.39
249 0.49
250 0.55
251 0.64
252 0.7
253 0.75
254 0.83
255 0.85
256 0.89
257 0.88
258 0.86
259 0.84
260 0.79
261 0.77
262 0.78
263 0.7
264 0.65
265 0.62
266 0.57
267 0.54
268 0.57
269 0.6
270 0.61
271 0.64
272 0.69
273 0.69
274 0.67
275 0.68
276 0.62
277 0.62
278 0.54
279 0.58