Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DZK5

Protein Details
Accession C5DZK5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
PositionSequence
39-66GKRRYDRKQRGFGGQTKPIFRRKAKTTK
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG zro:ZYRO0G05192g  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQRGFGGQTKPIFRRKAKTTKKVVLRLECVQCKTRAQLSLKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.84
4 0.89
5 0.88
6 0.89
7 0.89
8 0.9
9 0.88
10 0.89
11 0.89
12 0.82
13 0.82
14 0.76
15 0.7
16 0.62
17 0.56
18 0.45
19 0.37
20 0.35
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.51
30 0.58
31 0.67
32 0.68
33 0.7
34 0.69
35 0.7
36 0.69
37 0.68
38 0.63
39 0.58
40 0.52
41 0.47
42 0.47
43 0.46
44 0.47
45 0.43
46 0.44
47 0.46
48 0.54
49 0.61
50 0.66
51 0.69
52 0.71
53 0.76
54 0.77
55 0.76
56 0.7
57 0.66
58 0.63
59 0.62
60 0.58
61 0.53
62 0.48
63 0.43
64 0.4
65 0.38
66 0.36
67 0.36
68 0.37
69 0.42
70 0.48
71 0.57
72 0.62
73 0.64
74 0.61
75 0.58
76 0.57
77 0.52
78 0.5
79 0.5
80 0.51
81 0.55
82 0.62
83 0.59
84 0.59
85 0.61
86 0.57