Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DYX5

Protein Details
Accession C5DYX5   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
316-340QGQGQSLRKSSKRRDKSDHESSKAKHydrophilic
NLS Segment(s)
PositionSequence
325-331SSKRRDK
Subcellular Location(s) cyto_nucl 13, nucl 11, cyto 11, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004854  Ufd1-like  
IPR042299  Ufd1-like_Nn  
Gene Ontology GO:0050896  P:response to stimulus  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
KEGG zro:ZYRO0F16522g  -  
Pfam View protein in Pfam  
PF03152  UFD1  
Amino Acid Sequences MFSGISSFGGGFVNIPQKFEEFFRCYPVAMMNDRIRKDDANFGGKIFLPPSALSKLTMLNVRYPMLFELTANENGKVTHGGVLEFIAEEGRAYLPQWMMETLGVQPGSLLKIGSTDLPLGQFVKIQPQSVDFLDITDPKAVLENVLRKFSTLTVDDIIEINYNDSLYRIKVLEVKPDTSSRGVCVIETDLVTDFAPPVGYVEPDYKELQKQKAEEIRRTKQDPSAHENGSMSRRINYKGMIKDHQKIQSGFVGDGQKLSGKPANKSSEPEDFSRIKISLDDEPLKLDLPEGQLFFGFPIVLPKDSEEEDTQINKFQGQGQSLRKSSKRRDKSDHESSKAKAPRSPEAIEID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.22
4 0.23
5 0.25
6 0.28
7 0.31
8 0.29
9 0.3
10 0.36
11 0.35
12 0.34
13 0.33
14 0.35
15 0.31
16 0.28
17 0.35
18 0.36
19 0.42
20 0.43
21 0.45
22 0.43
23 0.41
24 0.4
25 0.42
26 0.4
27 0.39
28 0.38
29 0.35
30 0.35
31 0.33
32 0.32
33 0.23
34 0.18
35 0.14
36 0.14
37 0.18
38 0.19
39 0.19
40 0.18
41 0.19
42 0.2
43 0.21
44 0.25
45 0.22
46 0.24
47 0.25
48 0.25
49 0.24
50 0.23
51 0.21
52 0.19
53 0.18
54 0.13
55 0.14
56 0.17
57 0.23
58 0.23
59 0.22
60 0.19
61 0.19
62 0.2
63 0.18
64 0.15
65 0.13
66 0.12
67 0.12
68 0.12
69 0.12
70 0.11
71 0.1
72 0.09
73 0.05
74 0.05
75 0.04
76 0.05
77 0.05
78 0.05
79 0.06
80 0.08
81 0.09
82 0.09
83 0.1
84 0.1
85 0.1
86 0.1
87 0.1
88 0.08
89 0.11
90 0.1
91 0.09
92 0.09
93 0.09
94 0.1
95 0.09
96 0.08
97 0.05
98 0.06
99 0.07
100 0.08
101 0.08
102 0.07
103 0.08
104 0.08
105 0.09
106 0.09
107 0.09
108 0.1
109 0.09
110 0.17
111 0.18
112 0.18
113 0.18
114 0.19
115 0.21
116 0.2
117 0.22
118 0.13
119 0.13
120 0.14
121 0.14
122 0.13
123 0.12
124 0.11
125 0.09
126 0.1
127 0.09
128 0.09
129 0.12
130 0.17
131 0.18
132 0.21
133 0.21
134 0.2
135 0.21
136 0.2
137 0.2
138 0.14
139 0.14
140 0.13
141 0.13
142 0.13
143 0.13
144 0.12
145 0.09
146 0.08
147 0.07
148 0.06
149 0.06
150 0.05
151 0.05
152 0.06
153 0.05
154 0.07
155 0.07
156 0.07
157 0.13
158 0.14
159 0.21
160 0.22
161 0.24
162 0.24
163 0.25
164 0.26
165 0.22
166 0.21
167 0.14
168 0.15
169 0.14
170 0.12
171 0.12
172 0.11
173 0.1
174 0.1
175 0.09
176 0.07
177 0.07
178 0.08
179 0.07
180 0.06
181 0.05
182 0.05
183 0.04
184 0.05
185 0.05
186 0.05
187 0.06
188 0.09
189 0.1
190 0.12
191 0.14
192 0.14
193 0.19
194 0.23
195 0.27
196 0.28
197 0.28
198 0.33
199 0.39
200 0.43
201 0.46
202 0.5
203 0.53
204 0.56
205 0.58
206 0.53
207 0.52
208 0.52
209 0.5
210 0.48
211 0.48
212 0.42
213 0.4
214 0.38
215 0.35
216 0.32
217 0.3
218 0.23
219 0.2
220 0.22
221 0.23
222 0.25
223 0.26
224 0.3
225 0.33
226 0.37
227 0.41
228 0.44
229 0.47
230 0.51
231 0.53
232 0.51
233 0.46
234 0.43
235 0.4
236 0.36
237 0.31
238 0.29
239 0.26
240 0.21
241 0.21
242 0.18
243 0.17
244 0.15
245 0.19
246 0.18
247 0.18
248 0.22
249 0.3
250 0.36
251 0.35
252 0.39
253 0.4
254 0.44
255 0.44
256 0.43
257 0.41
258 0.36
259 0.36
260 0.36
261 0.31
262 0.23
263 0.22
264 0.22
265 0.21
266 0.27
267 0.28
268 0.25
269 0.27
270 0.27
271 0.26
272 0.22
273 0.18
274 0.14
275 0.15
276 0.18
277 0.16
278 0.16
279 0.16
280 0.16
281 0.16
282 0.13
283 0.09
284 0.06
285 0.12
286 0.14
287 0.15
288 0.15
289 0.17
290 0.19
291 0.2
292 0.24
293 0.2
294 0.2
295 0.23
296 0.25
297 0.25
298 0.26
299 0.25
300 0.22
301 0.21
302 0.25
303 0.26
304 0.27
305 0.34
306 0.38
307 0.46
308 0.5
309 0.56
310 0.57
311 0.62
312 0.69
313 0.72
314 0.74
315 0.76
316 0.82
317 0.84
318 0.87
319 0.88
320 0.88
321 0.83
322 0.78
323 0.71
324 0.71
325 0.68
326 0.61
327 0.53
328 0.49
329 0.52
330 0.52
331 0.53