Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5E021

Protein Details
Accession C5E021   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
82-109VIPLRSTTVSKNKKKNKIRCSYCNEMGHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG zro:ZYRO0G09064g  -  
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MSDNQSLRVSQALDNLAKTILEQRDSSSYNEKLRRLEALINMILQTDSNGSKMDTTKLDSILREDDIEIIEKNHQRYALIPVIPLRSTTVSKNKKKNKIRCSYCNEMGHTRANCEKKLQPQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.2
4 0.18
5 0.17
6 0.2
7 0.18
8 0.19
9 0.19
10 0.21
11 0.26
12 0.28
13 0.3
14 0.3
15 0.32
16 0.37
17 0.42
18 0.42
19 0.39
20 0.39
21 0.38
22 0.34
23 0.33
24 0.27
25 0.26
26 0.24
27 0.22
28 0.2
29 0.17
30 0.15
31 0.11
32 0.09
33 0.07
34 0.06
35 0.07
36 0.07
37 0.07
38 0.09
39 0.1
40 0.11
41 0.11
42 0.13
43 0.14
44 0.16
45 0.17
46 0.15
47 0.16
48 0.15
49 0.15
50 0.12
51 0.11
52 0.09
53 0.09
54 0.09
55 0.08
56 0.07
57 0.11
58 0.14
59 0.15
60 0.16
61 0.16
62 0.15
63 0.16
64 0.21
65 0.22
66 0.2
67 0.19
68 0.2
69 0.22
70 0.22
71 0.21
72 0.17
73 0.15
74 0.17
75 0.22
76 0.3
77 0.38
78 0.47
79 0.57
80 0.65
81 0.73
82 0.81
83 0.86
84 0.87
85 0.88
86 0.88
87 0.88
88 0.86
89 0.85
90 0.83
91 0.78
92 0.73
93 0.66
94 0.61
95 0.59
96 0.51
97 0.47
98 0.47
99 0.46
100 0.43
101 0.44
102 0.47