Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DY84

Protein Details
Accession C5DY84    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-34YTPIARKKNVFRPPVRNPQQVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, mito_nucl 14, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018468  SFR1/Mei5  
Gene Ontology GO:0005634  C:nucleus  
GO:0006281  P:DNA repair  
KEGG zro:ZYRO0F11044g  -  
Pfam View protein in Pfam  
PF10376  Mei5  
Amino Acid Sequences MDSNTPSNSSPNYTPIARKKNVFRPPVRNPQQVLSTPNTLVKTSVDKVDKGSIEDRRLAYELKLLNNEFTRQINSYKIENNQLNQSIKVLKNYEKEEKVMRLIEKWRSISQAGMSYMLNSTMLKITKIGGYEELKRKEMEAEKRKIEYQVDDNLQDEMDNVLESEEFQMLPEEDQEEYKNRMQDKIEEMEIWKEKALTKLEEQVKLSANQEMTMQELAQRLKINYQFVFPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.52
4 0.52
5 0.56
6 0.62
7 0.68
8 0.74
9 0.75
10 0.74
11 0.74
12 0.79
13 0.84
14 0.83
15 0.8
16 0.74
17 0.69
18 0.67
19 0.6
20 0.55
21 0.49
22 0.43
23 0.37
24 0.39
25 0.35
26 0.29
27 0.26
28 0.23
29 0.24
30 0.23
31 0.28
32 0.27
33 0.26
34 0.28
35 0.33
36 0.32
37 0.29
38 0.33
39 0.32
40 0.33
41 0.37
42 0.34
43 0.31
44 0.32
45 0.3
46 0.24
47 0.24
48 0.24
49 0.22
50 0.25
51 0.22
52 0.24
53 0.24
54 0.25
55 0.22
56 0.21
57 0.21
58 0.19
59 0.2
60 0.21
61 0.22
62 0.23
63 0.25
64 0.27
65 0.31
66 0.32
67 0.32
68 0.32
69 0.34
70 0.33
71 0.29
72 0.28
73 0.26
74 0.25
75 0.27
76 0.25
77 0.25
78 0.29
79 0.34
80 0.39
81 0.35
82 0.36
83 0.35
84 0.34
85 0.32
86 0.3
87 0.26
88 0.23
89 0.26
90 0.29
91 0.29
92 0.3
93 0.28
94 0.28
95 0.27
96 0.25
97 0.21
98 0.2
99 0.17
100 0.15
101 0.14
102 0.12
103 0.12
104 0.11
105 0.09
106 0.06
107 0.06
108 0.07
109 0.07
110 0.07
111 0.07
112 0.08
113 0.09
114 0.1
115 0.1
116 0.11
117 0.13
118 0.2
119 0.27
120 0.29
121 0.29
122 0.28
123 0.28
124 0.3
125 0.35
126 0.39
127 0.41
128 0.44
129 0.46
130 0.48
131 0.49
132 0.46
133 0.41
134 0.34
135 0.29
136 0.3
137 0.28
138 0.27
139 0.26
140 0.24
141 0.22
142 0.18
143 0.14
144 0.08
145 0.06
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.06
152 0.06
153 0.06
154 0.06
155 0.07
156 0.07
157 0.08
158 0.08
159 0.08
160 0.08
161 0.1
162 0.11
163 0.14
164 0.18
165 0.21
166 0.24
167 0.24
168 0.28
169 0.29
170 0.32
171 0.34
172 0.34
173 0.32
174 0.29
175 0.29
176 0.32
177 0.33
178 0.29
179 0.24
180 0.21
181 0.22
182 0.26
183 0.29
184 0.25
185 0.26
186 0.34
187 0.4
188 0.43
189 0.43
190 0.41
191 0.4
192 0.38
193 0.36
194 0.32
195 0.26
196 0.22
197 0.22
198 0.19
199 0.18
200 0.17
201 0.15
202 0.14
203 0.18
204 0.18
205 0.21
206 0.24
207 0.22
208 0.29
209 0.34
210 0.37
211 0.33