Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DSW2

Protein Details
Accession C5DSW2    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-120QLDEKMLKRKHRRAMVQNHPDKGBasic
NLS Segment(s)
Subcellular Location(s) plas 8, nucl 6, mito 5, golg 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
KEGG zro:ZYRO0C03454g  -  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
Amino Acid Sequences MVLPLIVGICVAGISLTARSGIRAWEIYKVLSPMTIARMNKVRIKESPKWPGTQRFLSSRLDPELQRKLNEYPGGFNPRMTESEAFLILNISPTEIEQLDEKMLKRKHRRAMVQNHPDKGGSPYLAIKINEARDVLEESCMVKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.07
5 0.07
6 0.08
7 0.09
8 0.1
9 0.13
10 0.15
11 0.16
12 0.19
13 0.2
14 0.2
15 0.21
16 0.21
17 0.18
18 0.15
19 0.15
20 0.11
21 0.15
22 0.19
23 0.18
24 0.21
25 0.27
26 0.3
27 0.34
28 0.35
29 0.34
30 0.35
31 0.44
32 0.48
33 0.51
34 0.58
35 0.56
36 0.57
37 0.59
38 0.61
39 0.58
40 0.55
41 0.49
42 0.43
43 0.44
44 0.42
45 0.39
46 0.33
47 0.3
48 0.27
49 0.25
50 0.26
51 0.32
52 0.3
53 0.29
54 0.29
55 0.28
56 0.3
57 0.31
58 0.26
59 0.2
60 0.23
61 0.28
62 0.26
63 0.24
64 0.22
65 0.2
66 0.21
67 0.21
68 0.17
69 0.13
70 0.14
71 0.14
72 0.12
73 0.1
74 0.1
75 0.07
76 0.08
77 0.07
78 0.06
79 0.05
80 0.05
81 0.07
82 0.07
83 0.08
84 0.07
85 0.08
86 0.1
87 0.12
88 0.13
89 0.2
90 0.24
91 0.33
92 0.43
93 0.51
94 0.58
95 0.65
96 0.73
97 0.75
98 0.81
99 0.83
100 0.84
101 0.82
102 0.75
103 0.68
104 0.58
105 0.49
106 0.42
107 0.35
108 0.25
109 0.2
110 0.2
111 0.21
112 0.27
113 0.25
114 0.25
115 0.27
116 0.28
117 0.29
118 0.27
119 0.24
120 0.21
121 0.25
122 0.22
123 0.18
124 0.17
125 0.16