FuNGI

C5DPN1

Protein Details

Accession

C5DPN1

Localization Confidence

Medium

Confidence Score

14.2

NoLS Segment(s)

Position	Sequence	Protein Nature
359-389	RPIERRSTFPSNKQRFHKKRSVDRRVPNLGL	Hydrophilic

NLS Segment(s)

Position	Sequence
370-378	NKQRFHKKR

Subcellular Location(s)

nucl 24, cyto_nucl 14.5

Family & Domain DBs

InterPro	View protein in InterPro IPR003593 AAA+_ATPase IPR013632 DNA_recomb/repair_Rad51_C IPR027417 P-loop_NTPase IPR020588 RecA_ATP-bd IPR047348 XRCC3-like_C
Gene Ontology	GO:0005524 F:ATP binding GO:0140664 F:ATP-dependent DNA damage sensor activity GO:0003677 F:DNA binding GO:0006310 P:DNA recombination GO:0006281 P:DNA repair GO:0061982 P:meiosis I cell cycle process
KEGG	zro:ZYRO0A04708g -
Pfam	View protein in Pfam PF08423 Rad51
PROSITE	View protein in PROSITE PS50162 RECA_2
CDD	cd19491 XRCC3

Amino Acid Sequences

MDLYDELPQSSLLCDEEFTSLLDACKKYQVSVVDFLTLPSKELARQLQRSTNEVDKFQKSMIAEYDDQLMNFNEVKPISEVEGPVPFTTTDVGIDEALGGGIYTHGITEVFGESSTGKSQLLMQLCLSVQLPTNMGGIKGKCVYISTEGDLPTQRLASMISAREELVKHGVSQENVYTVTCCDLINQDHILNVQLPILLENSRGAIKLIIIDSISHHMRVELPTRDFKDHQDNRFYVDQVAERLLDLANKHALAVVVANQVSDRPLFESPEPYVAELTDYEYQLGWWVGWRNSSIIYHQKYNEPKNVNSDYQDNEDLLSDDEDGKLIHDEIARVENLSRTKAAKVTVANSEKALPPDKRPIERRSTFPSNKQRFHKKRSVDRRVPNLGLNWAKHLSSRILLSKSYRASPMIRRGELHLYKGSDPTTFWQVKRLFKVVFSAYADSKEIPFMITKRGLESSLGDD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.1
2	0.11
3	0.13
4	0.13
5	0.13
6	0.14
7	0.13
8	0.15
9	0.2
10	0.2
11	0.2
12	0.27
13	0.26
14	0.25
15	0.29
16	0.33
17	0.32
18	0.37
19	0.36
20	0.32
21	0.32
22	0.31
23	0.31
24	0.25
25	0.22
26	0.17
27	0.17
28	0.16
29	0.22
30	0.3
31	0.34
32	0.41
33	0.45
34	0.51
35	0.52
36	0.54
37	0.54
38	0.53
39	0.48
40	0.46
41	0.47
42	0.43
43	0.42
44	0.39
45	0.37
46	0.3
47	0.3
48	0.28
49	0.27
50	0.25
51	0.24
52	0.29
53	0.25
54	0.25
55	0.23
56	0.2
57	0.17
58	0.17
59	0.16
60	0.15
61	0.15
62	0.16
63	0.16
64	0.17
65	0.17
66	0.18
67	0.18
68	0.17
69	0.2
70	0.2
71	0.18
72	0.18
73	0.16
74	0.14
75	0.14
76	0.12
77	0.1
78	0.09
79	0.1
80	0.08
81	0.08
82	0.08
83	0.07
84	0.06
85	0.05
86	0.04
87	0.03
88	0.03
89	0.03
90	0.03
91	0.03
92	0.04
93	0.04
94	0.04
95	0.05
96	0.06
97	0.06
98	0.06
99	0.07
100	0.08
101	0.09
102	0.11
103	0.1
104	0.09
105	0.09
106	0.11
107	0.16
108	0.17
109	0.17
110	0.16
111	0.17
112	0.17
113	0.18
114	0.16
115	0.12
116	0.1
117	0.1
118	0.11
119	0.1
120	0.11
121	0.1
122	0.11
123	0.13
124	0.13
125	0.15
126	0.15
127	0.15
128	0.14
129	0.14
130	0.16
131	0.17
132	0.18
133	0.17
134	0.19
135	0.19
136	0.21
137	0.21
138	0.19
139	0.15
140	0.13
141	0.11
142	0.09
143	0.09
144	0.09
145	0.11
146	0.12
147	0.13
148	0.13
149	0.13
150	0.15
151	0.15
152	0.14
153	0.15
154	0.13
155	0.12
156	0.15
157	0.17
158	0.16
159	0.16
160	0.15
161	0.13
162	0.13
163	0.13
164	0.1
165	0.09
166	0.09
167	0.09
168	0.08
169	0.07
170	0.1
171	0.11
172	0.13
173	0.14
174	0.13
175	0.13
176	0.13
177	0.13
178	0.11
179	0.1
180	0.08
181	0.07
182	0.06
183	0.07
184	0.07
185	0.07
186	0.07
187	0.07
188	0.07
189	0.07
190	0.07
191	0.07
192	0.06
193	0.06
194	0.07
195	0.07
196	0.07
197	0.06
198	0.06
199	0.07
200	0.1
201	0.11
202	0.09
203	0.09
204	0.09
205	0.1
206	0.12
207	0.16
208	0.17
209	0.19
210	0.23
211	0.26
212	0.29
213	0.28
214	0.29
215	0.36
216	0.38
217	0.4
218	0.42
219	0.39
220	0.4
221	0.41
222	0.38
223	0.28
224	0.23
225	0.2
226	0.14
227	0.15
228	0.11
229	0.09
230	0.09
231	0.08
232	0.08
233	0.07
234	0.08
235	0.08
236	0.08
237	0.08
238	0.08
239	0.08
240	0.07
241	0.07
242	0.07
243	0.08
244	0.08
245	0.08
246	0.07
247	0.07
248	0.08
249	0.08
250	0.06
251	0.07
252	0.08
253	0.1
254	0.11
255	0.14
256	0.14
257	0.18
258	0.18
259	0.16
260	0.15
261	0.13
262	0.13
263	0.1
264	0.13
265	0.11
266	0.1
267	0.1
268	0.1
269	0.1
270	0.1
271	0.1
272	0.07
273	0.07
274	0.1
275	0.1
276	0.12
277	0.13
278	0.12
279	0.14
280	0.14
281	0.16
282	0.22
283	0.24
284	0.27
285	0.28
286	0.34
287	0.4
288	0.45
289	0.49
290	0.45
291	0.44
292	0.47
293	0.5
294	0.45
295	0.4
296	0.38
297	0.32
298	0.32
299	0.31
300	0.24
301	0.19
302	0.18
303	0.16
304	0.14
305	0.12
306	0.08
307	0.08
308	0.08
309	0.08
310	0.07
311	0.07
312	0.07
313	0.07
314	0.08
315	0.09
316	0.09
317	0.1
318	0.13
319	0.12
320	0.12
321	0.12
322	0.14
323	0.15
324	0.17
325	0.18
326	0.17
327	0.19
328	0.21
329	0.22
330	0.22
331	0.23
332	0.24
333	0.31
334	0.33
335	0.32
336	0.3
337	0.31
338	0.29
339	0.29
340	0.33
341	0.26
342	0.28
343	0.37
344	0.43
345	0.49
346	0.54
347	0.58
348	0.61
349	0.63
350	0.64
351	0.63
352	0.67
353	0.65
354	0.68
355	0.72
356	0.72
357	0.75
358	0.79
359	0.81
360	0.81
361	0.84
362	0.83
363	0.82
364	0.83
365	0.87
366	0.89
367	0.87
368	0.87
369	0.87
370	0.86
371	0.78
372	0.71
373	0.62
374	0.59
375	0.55
376	0.46
377	0.42
378	0.35
379	0.33
380	0.31
381	0.31
382	0.26
383	0.22
384	0.26
385	0.27
386	0.28
387	0.3
388	0.33
389	0.37
390	0.38
391	0.38
392	0.36
393	0.34
394	0.37
395	0.43
396	0.49
397	0.51
398	0.49
399	0.48
400	0.5
401	0.57
402	0.54
403	0.5
404	0.46
405	0.41
406	0.4
407	0.42
408	0.38
409	0.29
410	0.27
411	0.27
412	0.31
413	0.33
414	0.31
415	0.37
416	0.42
417	0.49
418	0.54
419	0.56
420	0.48
421	0.44
422	0.5
423	0.44
424	0.44
425	0.4
426	0.37
427	0.32
428	0.34
429	0.34
430	0.29
431	0.26
432	0.22
433	0.19
434	0.16
435	0.19
436	0.18
437	0.24
438	0.28
439	0.28
440	0.31
441	0.33
442	0.33
443	0.3

C5DPN1

3D AlphaFold-predicted Structure Viewer