Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DRE0

Protein Details
Accession C5DRE0    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MPQKSLRVNKKQKDPRRITKKQKNPKRAAPLQIKSHydrophilic
69-88LVKGNRKEIEKEKQKNNNKKBasic
NLS Segment(s)
PositionSequence
7-42RVNKKQKDPRRITKKQKNPKRAAPLQIKSKKKSLNK
75-88KEIEKEKQKNNNKK
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG zro:ZYRO0B07700g  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQKSLRVNKKQKDPRRITKKQKNPKRAAPLQIKSKKKSLNKFKELNKTVSLTAATEKIIASRVGHLELVKGNRKEIEKEKQKNNNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.89
4 0.91
5 0.92
6 0.92
7 0.93
8 0.93
9 0.93
10 0.93
11 0.9
12 0.89
13 0.88
14 0.84
15 0.82
16 0.81
17 0.78
18 0.77
19 0.78
20 0.75
21 0.68
22 0.68
23 0.66
24 0.64
25 0.67
26 0.68
27 0.69
28 0.7
29 0.74
30 0.75
31 0.77
32 0.73
33 0.66
34 0.57
35 0.48
36 0.4
37 0.34
38 0.27
39 0.17
40 0.15
41 0.13
42 0.11
43 0.09
44 0.09
45 0.08
46 0.09
47 0.09
48 0.09
49 0.11
50 0.12
51 0.13
52 0.14
53 0.13
54 0.13
55 0.17
56 0.22
57 0.28
58 0.27
59 0.28
60 0.32
61 0.35
62 0.4
63 0.44
64 0.49
65 0.52
66 0.6
67 0.69
68 0.75