Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DSC8

Protein Details
Accession C5DSC8   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
39-65SHSGSRVSKKSNKKKKNQCYFDKCTSPHydrophilic
NLS Segment(s)
PositionSequence
46-54SKKSNKKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 14.333, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
KEGG zro:ZYRO0B15818g  -  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MSSNTSIEEQKLQQQQQEPQQSEEVKVVVGTGGVSSKESHSGSRVSKKSNKKKKNQCYFDKCTSPASKFIGDCNFCKGHYCSKHRLMENHACEGLTSCKETMHKRNADKLVSEQTKAPKIQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.52
4 0.6
5 0.54
6 0.48
7 0.52
8 0.48
9 0.44
10 0.38
11 0.29
12 0.2
13 0.17
14 0.14
15 0.09
16 0.07
17 0.06
18 0.04
19 0.05
20 0.05
21 0.06
22 0.07
23 0.08
24 0.12
25 0.12
26 0.13
27 0.14
28 0.18
29 0.22
30 0.31
31 0.33
32 0.36
33 0.44
34 0.54
35 0.63
36 0.7
37 0.74
38 0.76
39 0.84
40 0.88
41 0.91
42 0.89
43 0.89
44 0.87
45 0.84
46 0.8
47 0.73
48 0.63
49 0.58
50 0.52
51 0.43
52 0.37
53 0.32
54 0.28
55 0.25
56 0.27
57 0.28
58 0.27
59 0.26
60 0.28
61 0.26
62 0.23
63 0.27
64 0.26
65 0.28
66 0.35
67 0.41
68 0.43
69 0.51
70 0.58
71 0.58
72 0.6
73 0.59
74 0.6
75 0.57
76 0.53
77 0.45
78 0.38
79 0.34
80 0.33
81 0.29
82 0.2
83 0.19
84 0.15
85 0.17
86 0.22
87 0.29
88 0.36
89 0.42
90 0.49
91 0.52
92 0.61
93 0.65
94 0.64
95 0.59
96 0.56
97 0.56
98 0.52
99 0.48
100 0.44
101 0.45
102 0.48