Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2HDJ8

Protein Details
Accession Q2HDJ8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
211-245GETKEERRARRAERRERKEAKRRRREGATQKSDQGBasic
NLS Segment(s)
PositionSequence
152-237GKKRGKRDGSESKLERRARRAARSLRKADKAARKAAAARAAQKAVEKAAKKELKRARKAGETKEERRARRAERRERKEAKRRRREG
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MDAAALLKSQGWRGTGFSLHPTNDAIGLAKPLLISRNTDGRGIGQKKHYTSDQWWLQAFDQKLKGLDTTSKKGSVVQSVTQGKLDVIAASQPNGKYTGASGLYASFVRGGLLDGTKQEEEEEDGIRTAESTDATPATSSSDDSEGVAGSASGKKRGKRDGSESKLERRARRAARSLRKADKAARKAAAARAAQKAVEKAAKKELKRARKAGETKEERRARRAERRERKEAKRRRREGATQKSDQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.27
5 0.29
6 0.28
7 0.28
8 0.27
9 0.24
10 0.23
11 0.21
12 0.16
13 0.12
14 0.12
15 0.11
16 0.1
17 0.1
18 0.1
19 0.13
20 0.13
21 0.16
22 0.18
23 0.26
24 0.27
25 0.27
26 0.27
27 0.28
28 0.36
29 0.37
30 0.38
31 0.38
32 0.43
33 0.44
34 0.47
35 0.46
36 0.41
37 0.41
38 0.46
39 0.43
40 0.41
41 0.4
42 0.38
43 0.37
44 0.38
45 0.36
46 0.31
47 0.29
48 0.26
49 0.26
50 0.24
51 0.24
52 0.19
53 0.26
54 0.26
55 0.29
56 0.3
57 0.3
58 0.3
59 0.33
60 0.33
61 0.31
62 0.28
63 0.25
64 0.3
65 0.32
66 0.32
67 0.29
68 0.27
69 0.21
70 0.18
71 0.17
72 0.09
73 0.06
74 0.08
75 0.08
76 0.09
77 0.12
78 0.11
79 0.11
80 0.13
81 0.13
82 0.1
83 0.1
84 0.14
85 0.12
86 0.12
87 0.11
88 0.1
89 0.11
90 0.11
91 0.1
92 0.06
93 0.06
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.06
101 0.08
102 0.08
103 0.08
104 0.07
105 0.07
106 0.08
107 0.09
108 0.09
109 0.07
110 0.07
111 0.08
112 0.07
113 0.07
114 0.06
115 0.05
116 0.05
117 0.05
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.07
126 0.07
127 0.08
128 0.08
129 0.09
130 0.09
131 0.07
132 0.06
133 0.06
134 0.05
135 0.05
136 0.08
137 0.08
138 0.15
139 0.19
140 0.22
141 0.28
142 0.36
143 0.42
144 0.44
145 0.53
146 0.57
147 0.6
148 0.66
149 0.65
150 0.63
151 0.65
152 0.66
153 0.6
154 0.55
155 0.59
156 0.56
157 0.6
158 0.62
159 0.64
160 0.69
161 0.74
162 0.77
163 0.76
164 0.74
165 0.71
166 0.7
167 0.7
168 0.65
169 0.62
170 0.56
171 0.5
172 0.48
173 0.48
174 0.47
175 0.39
176 0.38
177 0.36
178 0.35
179 0.33
180 0.32
181 0.29
182 0.26
183 0.3
184 0.27
185 0.26
186 0.35
187 0.41
188 0.4
189 0.49
190 0.54
191 0.58
192 0.65
193 0.7
194 0.66
195 0.7
196 0.76
197 0.76
198 0.77
199 0.76
200 0.73
201 0.76
202 0.77
203 0.71
204 0.7
205 0.69
206 0.68
207 0.7
208 0.75
209 0.75
210 0.78
211 0.84
212 0.88
213 0.89
214 0.91
215 0.9
216 0.91
217 0.91
218 0.91
219 0.89
220 0.88
221 0.87
222 0.87
223 0.87
224 0.88
225 0.86