Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DQZ0

Protein Details
Accession C5DQZ0    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-30SLPHPKIVKKHAKAFRRYQSDRFKRVPHydrophilic
NLS Segment(s)
PositionSequence
10-37IVKKHAKAFRRYQSDRFKRVPESHRKQR
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG zro:ZYRO0B04114g  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAPSLPHPKIVKKHAKAFRRYQSDRFKRVPESHRKQRGIDSCVRKKFKGYPAEPKIGYGSNKKTKHLSPSGHKVFLVANVKDLEVLTMHSKSYAAEIAHNVSSRKRVDILARAKALGVKVTNPKGRLSLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.79
4 0.81
5 0.81
6 0.8
7 0.79
8 0.78
9 0.8
10 0.81
11 0.8
12 0.75
13 0.71
14 0.68
15 0.71
16 0.72
17 0.71
18 0.72
19 0.75
20 0.8
21 0.78
22 0.72
23 0.72
24 0.7
25 0.64
26 0.63
27 0.63
28 0.62
29 0.68
30 0.69
31 0.61
32 0.57
33 0.59
34 0.58
35 0.58
36 0.54
37 0.56
38 0.57
39 0.63
40 0.59
41 0.51
42 0.45
43 0.38
44 0.35
45 0.3
46 0.32
47 0.36
48 0.37
49 0.38
50 0.4
51 0.39
52 0.44
53 0.45
54 0.43
55 0.4
56 0.49
57 0.51
58 0.48
59 0.46
60 0.39
61 0.32
62 0.33
63 0.32
64 0.21
65 0.2
66 0.19
67 0.19
68 0.19
69 0.18
70 0.13
71 0.07
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.12
81 0.1
82 0.11
83 0.13
84 0.15
85 0.17
86 0.19
87 0.18
88 0.17
89 0.23
90 0.22
91 0.23
92 0.22
93 0.23
94 0.28
95 0.36
96 0.42
97 0.44
98 0.44
99 0.42
100 0.4
101 0.39
102 0.34
103 0.29
104 0.23
105 0.22
106 0.29
107 0.37
108 0.42
109 0.42
110 0.43
111 0.42