Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DQ51

Protein Details
Accession C5DQ51    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
115-134YKSTKNCKKFQCYERNQKLLHydrophilic
172-200DKLIEEEKLRKREKKLKKRNPDKEDELVNBasic
NLS Segment(s)
PositionSequence
179-191KLRKREKKLKKRN
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
KEGG zro:ZYRO0A08668g  -  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MVYVYESKPIDTFDSHFIISGRDQFENDLLIKYGFREWGLIWFHTDKYSSGHIYLKLLPHEKSLDDVPDEVLQDCLQLCKSNSIQGNKLGQCKIITTPWHNLRKSGFMKPGEVSYKSTKNCKKFQCYERNQKLLNRLCKTRVELYDAEPLLHQAKKEKDACALLEYVEANHDKLIEEEKLRKREKKLKKRNPDKEDELVNDQSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.24
4 0.22
5 0.21
6 0.21
7 0.24
8 0.22
9 0.2
10 0.21
11 0.21
12 0.22
13 0.22
14 0.21
15 0.16
16 0.14
17 0.14
18 0.13
19 0.13
20 0.14
21 0.13
22 0.12
23 0.12
24 0.12
25 0.18
26 0.21
27 0.2
28 0.22
29 0.23
30 0.23
31 0.23
32 0.24
33 0.18
34 0.18
35 0.21
36 0.19
37 0.19
38 0.22
39 0.21
40 0.23
41 0.25
42 0.24
43 0.25
44 0.27
45 0.26
46 0.25
47 0.26
48 0.23
49 0.23
50 0.21
51 0.18
52 0.15
53 0.15
54 0.14
55 0.14
56 0.14
57 0.12
58 0.11
59 0.09
60 0.09
61 0.09
62 0.08
63 0.07
64 0.09
65 0.09
66 0.13
67 0.13
68 0.18
69 0.23
70 0.25
71 0.27
72 0.29
73 0.35
74 0.33
75 0.37
76 0.32
77 0.28
78 0.26
79 0.25
80 0.22
81 0.19
82 0.19
83 0.18
84 0.26
85 0.33
86 0.4
87 0.39
88 0.39
89 0.37
90 0.42
91 0.42
92 0.4
93 0.37
94 0.31
95 0.33
96 0.31
97 0.34
98 0.29
99 0.27
100 0.26
101 0.24
102 0.3
103 0.3
104 0.38
105 0.41
106 0.45
107 0.52
108 0.55
109 0.59
110 0.62
111 0.7
112 0.72
113 0.75
114 0.8
115 0.81
116 0.79
117 0.74
118 0.68
119 0.68
120 0.65
121 0.65
122 0.58
123 0.53
124 0.5
125 0.51
126 0.52
127 0.49
128 0.43
129 0.39
130 0.36
131 0.36
132 0.4
133 0.36
134 0.32
135 0.25
136 0.25
137 0.22
138 0.22
139 0.19
140 0.18
141 0.22
142 0.3
143 0.33
144 0.33
145 0.34
146 0.36
147 0.37
148 0.32
149 0.29
150 0.21
151 0.19
152 0.18
153 0.14
154 0.14
155 0.13
156 0.11
157 0.11
158 0.11
159 0.1
160 0.11
161 0.15
162 0.15
163 0.19
164 0.28
165 0.36
166 0.45
167 0.52
168 0.58
169 0.64
170 0.71
171 0.78
172 0.8
173 0.84
174 0.86
175 0.9
176 0.94
177 0.95
178 0.94
179 0.92
180 0.88
181 0.84
182 0.8
183 0.74
184 0.69