Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DVQ2

Protein Details
Accession C5DVQ2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-62SQWNKSNKRKVVKIKKPQKKVVKSGVSHydrophilic
NLS Segment(s)
PositionSequence
40-57KSNKRKVVKIKKPQKKVV
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
KEGG zro:ZYRO0D08536g  -  
Amino Acid Sequences MSESNGKLSSRVMNMKFMRQTFDQPVEPPKPVRDGSQWNKSNKRKVVKIKKPQKKVVKSGVSISQLKGSPNAKREYSNDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.49
4 0.45
5 0.43
6 0.37
7 0.41
8 0.38
9 0.4
10 0.35
11 0.32
12 0.38
13 0.36
14 0.36
15 0.33
16 0.28
17 0.28
18 0.27
19 0.28
20 0.26
21 0.33
22 0.38
23 0.46
24 0.51
25 0.52
26 0.61
27 0.64
28 0.67
29 0.64
30 0.64
31 0.62
32 0.67
33 0.73
34 0.74
35 0.79
36 0.81
37 0.84
38 0.86
39 0.88
40 0.88
41 0.85
42 0.83
43 0.82
44 0.79
45 0.71
46 0.66
47 0.63
48 0.58
49 0.51
50 0.43
51 0.38
52 0.32
53 0.31
54 0.33
55 0.31
56 0.32
57 0.37
58 0.42
59 0.39
60 0.42