Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5E0K7

Protein Details
Accession C5E0K7   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
147-168CVPQFIYKVKTQKKKFKMWFKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024145  His_deAcase_SAP30/SAP30L  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Gene Ontology GO:0005634  C:nucleus  
KEGG zro:ZYRO0G13552g  -  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MARTANSNSESESNIKTRSAANTTAGTGVGSRSHVKQRLTTAQQQYLKDLVRTHVTNNHPNLTPKPDPMDFESYSDDFLRRYKDRFQLNVEDHLSIQGYLVGSQLGSKTYSSKRNQHGTPGARVLKKELASEVKRHFNSYNVKETECVPQFIYKVKTQKKKFKMWFKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.24
4 0.25
5 0.28
6 0.29
7 0.28
8 0.27
9 0.27
10 0.28
11 0.27
12 0.24
13 0.18
14 0.14
15 0.13
16 0.11
17 0.11
18 0.13
19 0.16
20 0.24
21 0.29
22 0.31
23 0.34
24 0.39
25 0.46
26 0.5
27 0.55
28 0.54
29 0.56
30 0.6
31 0.56
32 0.52
33 0.47
34 0.42
35 0.35
36 0.3
37 0.24
38 0.24
39 0.24
40 0.23
41 0.27
42 0.31
43 0.36
44 0.37
45 0.39
46 0.35
47 0.37
48 0.38
49 0.37
50 0.34
51 0.29
52 0.31
53 0.28
54 0.28
55 0.3
56 0.33
57 0.26
58 0.26
59 0.27
60 0.23
61 0.23
62 0.22
63 0.18
64 0.12
65 0.13
66 0.17
67 0.15
68 0.18
69 0.23
70 0.29
71 0.33
72 0.35
73 0.38
74 0.4
75 0.41
76 0.43
77 0.38
78 0.32
79 0.27
80 0.25
81 0.21
82 0.13
83 0.11
84 0.07
85 0.06
86 0.05
87 0.05
88 0.05
89 0.04
90 0.05
91 0.05
92 0.05
93 0.06
94 0.06
95 0.11
96 0.16
97 0.25
98 0.3
99 0.38
100 0.45
101 0.52
102 0.52
103 0.56
104 0.6
105 0.55
106 0.54
107 0.54
108 0.52
109 0.46
110 0.46
111 0.42
112 0.39
113 0.36
114 0.33
115 0.3
116 0.33
117 0.34
118 0.4
119 0.42
120 0.45
121 0.45
122 0.48
123 0.44
124 0.42
125 0.49
126 0.48
127 0.52
128 0.45
129 0.45
130 0.42
131 0.43
132 0.46
133 0.38
134 0.35
135 0.27
136 0.28
137 0.28
138 0.34
139 0.37
140 0.34
141 0.41
142 0.49
143 0.58
144 0.65
145 0.74
146 0.77
147 0.83
148 0.87