Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5E0M8

Protein Details
Accession C5E0M8   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-40RKPGSGRKPGKGKTLRNGRKPGSGRRRRDDDGBasic
NLS Segment(s)
PositionSequence
8-36GRKPGSGRKPGKGKTLRNGRKPGSGRRRR
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
KEGG zro:ZYRO0G14102g  -  
Amino Acid Sequences MAKTLSQGRKPGSGRKPGKGKTLRNGRKPGSGRRRRDDDGSPSPPQPPPQRSVNTGSTYGKTTAAAAAAAAEAAEAEAEAEAEAEAEAAAAAAATASASADDTTANSSSTTSAKSQVSSRDLEAIDALRELNNSPPEPLTPTLTPTQSKGRHTEIVQNHTNEGPFVTHTRLLSNPSASSNSNPSPAWNSLAHPQPVNGLVGMNSIGLSETSTQQDQNHTHSHHHSQSKEGPNGLLISSYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.68
3 0.75
4 0.71
5 0.77
6 0.77
7 0.76
8 0.76
9 0.8
10 0.81
11 0.8
12 0.85
13 0.78
14 0.78
15 0.76
16 0.77
17 0.77
18 0.77
19 0.77
20 0.76
21 0.81
22 0.75
23 0.74
24 0.71
25 0.69
26 0.68
27 0.65
28 0.59
29 0.53
30 0.53
31 0.49
32 0.49
33 0.49
34 0.45
35 0.43
36 0.47
37 0.5
38 0.5
39 0.54
40 0.53
41 0.47
42 0.46
43 0.44
44 0.37
45 0.35
46 0.32
47 0.26
48 0.2
49 0.18
50 0.14
51 0.12
52 0.1
53 0.07
54 0.07
55 0.06
56 0.05
57 0.04
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.03
87 0.03
88 0.03
89 0.04
90 0.06
91 0.06
92 0.06
93 0.06
94 0.07
95 0.08
96 0.09
97 0.1
98 0.09
99 0.13
100 0.13
101 0.14
102 0.16
103 0.18
104 0.2
105 0.2
106 0.19
107 0.19
108 0.19
109 0.18
110 0.16
111 0.12
112 0.1
113 0.09
114 0.08
115 0.05
116 0.05
117 0.06
118 0.09
119 0.11
120 0.11
121 0.12
122 0.12
123 0.12
124 0.15
125 0.16
126 0.16
127 0.14
128 0.17
129 0.18
130 0.2
131 0.21
132 0.2
133 0.28
134 0.28
135 0.31
136 0.32
137 0.34
138 0.36
139 0.37
140 0.43
141 0.4
142 0.42
143 0.44
144 0.41
145 0.37
146 0.34
147 0.33
148 0.24
149 0.19
150 0.13
151 0.1
152 0.11
153 0.13
154 0.14
155 0.14
156 0.16
157 0.17
158 0.2
159 0.21
160 0.21
161 0.2
162 0.2
163 0.22
164 0.21
165 0.22
166 0.24
167 0.23
168 0.24
169 0.23
170 0.23
171 0.25
172 0.26
173 0.27
174 0.22
175 0.23
176 0.26
177 0.32
178 0.32
179 0.28
180 0.27
181 0.25
182 0.25
183 0.24
184 0.18
185 0.12
186 0.1
187 0.1
188 0.1
189 0.08
190 0.06
191 0.06
192 0.06
193 0.05
194 0.06
195 0.07
196 0.09
197 0.13
198 0.14
199 0.16
200 0.17
201 0.24
202 0.26
203 0.3
204 0.35
205 0.34
206 0.39
207 0.43
208 0.49
209 0.51
210 0.56
211 0.52
212 0.52
213 0.59
214 0.63
215 0.62
216 0.55
217 0.47
218 0.42
219 0.42
220 0.35