Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DW49

Protein Details
Accession C5DW49   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
146-165VFYYKDQKRKHGRNLLRMVTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8mito 8cyto 8cyto_nucl 8cyto_mito 8mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036412  HAD-like_sf  
IPR009453  ISN1  
Gene Ontology GO:0050483  F:IMP 5'-nucleotidase activity  
GO:0000287  F:magnesium ion binding  
GO:0000166  F:nucleotide binding  
GO:0006190  P:inosine salvage  
GO:0009117  P:nucleotide metabolic process  
KEGG zro:ZYRO0D11902g  -  
Pfam View protein in Pfam  
PF06437  ISN1  
Amino Acid Sequences MSSRYRVEYHLKSHRKDGFVDWIKGLLAAPFVLHAVSHELDDLTTSQRVRSQYAQIFKDIEGLISNKIEFDAKSKELDQNGASDLDYELLGKSRLNKLVPTIGNFFTELPLEKAFLWEDTYGAISDRRMVAPSFNDVRRIMNTAQVFYYKDQKRKHGRNLLRMVTFDGDVTLYEDGGSLNYTNPVIPYLLKLLERDIYVGIVTAAGYDEAHKYESRLEGLITAVHDSISLTPAQKSHLTVMGGESNYLFQYHELSADNFGFRAVPQDEWLLTHMKSWEDKYMEQTLDFAEKILHTLKQRLKLPSEAPIIRKKRAVGIVPGEKFDPVTQRQVQVKLQREQLEEIVLTLQSSLETFLPARSIQFSCFDGGSDVWCDIGGKDLGLRVLQNFYDPVHPIKASETLHVGDQFAPVGSANDFKARLAGCTLWIASPAETVQNLHKLLDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.65
3 0.61
4 0.57
5 0.57
6 0.56
7 0.56
8 0.48
9 0.42
10 0.39
11 0.36
12 0.31
13 0.2
14 0.13
15 0.09
16 0.09
17 0.08
18 0.08
19 0.07
20 0.07
21 0.07
22 0.1
23 0.11
24 0.11
25 0.11
26 0.11
27 0.11
28 0.13
29 0.13
30 0.12
31 0.15
32 0.15
33 0.16
34 0.2
35 0.22
36 0.26
37 0.29
38 0.35
39 0.39
40 0.47
41 0.48
42 0.46
43 0.46
44 0.42
45 0.43
46 0.33
47 0.27
48 0.21
49 0.2
50 0.19
51 0.18
52 0.18
53 0.12
54 0.13
55 0.14
56 0.12
57 0.15
58 0.19
59 0.2
60 0.23
61 0.25
62 0.3
63 0.3
64 0.33
65 0.29
66 0.25
67 0.25
68 0.22
69 0.2
70 0.15
71 0.14
72 0.11
73 0.1
74 0.08
75 0.07
76 0.08
77 0.09
78 0.09
79 0.13
80 0.19
81 0.24
82 0.25
83 0.26
84 0.28
85 0.36
86 0.37
87 0.36
88 0.34
89 0.31
90 0.3
91 0.3
92 0.27
93 0.19
94 0.18
95 0.15
96 0.13
97 0.13
98 0.13
99 0.12
100 0.13
101 0.13
102 0.12
103 0.13
104 0.11
105 0.1
106 0.1
107 0.1
108 0.09
109 0.09
110 0.1
111 0.07
112 0.1
113 0.11
114 0.11
115 0.12
116 0.12
117 0.14
118 0.15
119 0.21
120 0.24
121 0.24
122 0.27
123 0.26
124 0.28
125 0.27
126 0.3
127 0.24
128 0.24
129 0.24
130 0.22
131 0.22
132 0.22
133 0.22
134 0.19
135 0.28
136 0.28
137 0.35
138 0.38
139 0.47
140 0.56
141 0.63
142 0.72
143 0.73
144 0.75
145 0.78
146 0.82
147 0.77
148 0.68
149 0.6
150 0.51
151 0.42
152 0.34
153 0.24
154 0.15
155 0.1
156 0.08
157 0.09
158 0.07
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.04
166 0.05
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.07
173 0.06
174 0.07
175 0.08
176 0.1
177 0.1
178 0.11
179 0.11
180 0.12
181 0.12
182 0.12
183 0.1
184 0.09
185 0.08
186 0.08
187 0.06
188 0.04
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.04
195 0.05
196 0.05
197 0.07
198 0.07
199 0.07
200 0.09
201 0.1
202 0.11
203 0.1
204 0.1
205 0.09
206 0.09
207 0.09
208 0.07
209 0.07
210 0.06
211 0.06
212 0.06
213 0.05
214 0.05
215 0.06
216 0.06
217 0.06
218 0.07
219 0.07
220 0.1
221 0.1
222 0.11
223 0.12
224 0.14
225 0.13
226 0.13
227 0.14
228 0.15
229 0.14
230 0.13
231 0.12
232 0.09
233 0.09
234 0.09
235 0.08
236 0.05
237 0.07
238 0.07
239 0.09
240 0.09
241 0.1
242 0.11
243 0.12
244 0.11
245 0.09
246 0.09
247 0.08
248 0.07
249 0.11
250 0.1
251 0.1
252 0.11
253 0.12
254 0.12
255 0.13
256 0.14
257 0.12
258 0.11
259 0.12
260 0.12
261 0.13
262 0.15
263 0.16
264 0.2
265 0.2
266 0.21
267 0.24
268 0.27
269 0.26
270 0.24
271 0.23
272 0.19
273 0.18
274 0.17
275 0.13
276 0.09
277 0.08
278 0.1
279 0.11
280 0.13
281 0.13
282 0.22
283 0.26
284 0.33
285 0.38
286 0.41
287 0.43
288 0.44
289 0.44
290 0.43
291 0.46
292 0.42
293 0.41
294 0.46
295 0.48
296 0.46
297 0.48
298 0.41
299 0.4
300 0.43
301 0.41
302 0.38
303 0.41
304 0.47
305 0.45
306 0.45
307 0.39
308 0.33
309 0.31
310 0.26
311 0.24
312 0.18
313 0.25
314 0.27
315 0.32
316 0.37
317 0.4
318 0.45
319 0.47
320 0.52
321 0.5
322 0.54
323 0.53
324 0.51
325 0.49
326 0.43
327 0.37
328 0.29
329 0.25
330 0.19
331 0.14
332 0.11
333 0.09
334 0.08
335 0.05
336 0.06
337 0.07
338 0.06
339 0.07
340 0.08
341 0.08
342 0.1
343 0.11
344 0.12
345 0.15
346 0.15
347 0.16
348 0.18
349 0.19
350 0.19
351 0.19
352 0.18
353 0.15
354 0.15
355 0.15
356 0.13
357 0.12
358 0.1
359 0.1
360 0.1
361 0.08
362 0.12
363 0.1
364 0.09
365 0.1
366 0.11
367 0.12
368 0.12
369 0.13
370 0.11
371 0.14
372 0.14
373 0.15
374 0.14
375 0.15
376 0.18
377 0.19
378 0.21
379 0.22
380 0.22
381 0.21
382 0.23
383 0.28
384 0.25
385 0.26
386 0.26
387 0.23
388 0.26
389 0.26
390 0.25
391 0.19
392 0.18
393 0.17
394 0.13
395 0.13
396 0.1
397 0.1
398 0.1
399 0.12
400 0.12
401 0.16
402 0.17
403 0.16
404 0.21
405 0.2
406 0.2
407 0.21
408 0.21
409 0.18
410 0.21
411 0.22
412 0.18
413 0.19
414 0.19
415 0.16
416 0.17
417 0.16
418 0.15
419 0.15
420 0.17
421 0.2
422 0.25
423 0.26