Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5E0S9

Protein Details
Accession C5E0S9    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
123-153EKTKRAFQIKEVTKRRNRRVRHAKNKADLTVHydrophilic
NLS Segment(s)
PositionSequence
134-147VTKRRNRRVRHAKN
Subcellular Location(s) mito 18.5, mito_nucl 13.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
KEGG zro:ZYRO0G15312g  -  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MFSRLFPRLSTPLRGSQQSLRSFHYCTPLFQKNTSSVTSTASNTVDITPLKYSNELYAVFRIHNRPYLVTLGDKVVLPFKLKQADVGDILNLNDVTTIGSRNYQLIDNPIDTKLFTLKATVLEKTKRAFQIKEVTKRRNRRVRHAKNKADLTVLRISELKVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.48
4 0.52
5 0.53
6 0.51
7 0.48
8 0.46
9 0.46
10 0.44
11 0.46
12 0.39
13 0.35
14 0.4
15 0.43
16 0.43
17 0.42
18 0.43
19 0.39
20 0.41
21 0.4
22 0.34
23 0.26
24 0.27
25 0.27
26 0.25
27 0.22
28 0.19
29 0.18
30 0.16
31 0.16
32 0.15
33 0.13
34 0.13
35 0.13
36 0.13
37 0.14
38 0.14
39 0.14
40 0.13
41 0.15
42 0.15
43 0.14
44 0.15
45 0.15
46 0.15
47 0.17
48 0.19
49 0.18
50 0.21
51 0.21
52 0.19
53 0.2
54 0.21
55 0.2
56 0.17
57 0.16
58 0.12
59 0.12
60 0.11
61 0.1
62 0.1
63 0.1
64 0.11
65 0.11
66 0.13
67 0.16
68 0.15
69 0.18
70 0.17
71 0.18
72 0.17
73 0.16
74 0.14
75 0.11
76 0.11
77 0.09
78 0.08
79 0.06
80 0.05
81 0.04
82 0.05
83 0.05
84 0.06
85 0.06
86 0.07
87 0.07
88 0.08
89 0.09
90 0.09
91 0.1
92 0.12
93 0.14
94 0.14
95 0.15
96 0.15
97 0.14
98 0.14
99 0.14
100 0.13
101 0.12
102 0.11
103 0.1
104 0.11
105 0.16
106 0.18
107 0.2
108 0.23
109 0.25
110 0.29
111 0.3
112 0.35
113 0.37
114 0.4
115 0.39
116 0.4
117 0.47
118 0.53
119 0.61
120 0.64
121 0.67
122 0.72
123 0.81
124 0.85
125 0.84
126 0.82
127 0.83
128 0.86
129 0.87
130 0.89
131 0.9
132 0.89
133 0.89
134 0.88
135 0.79
136 0.74
137 0.64
138 0.58
139 0.54
140 0.45
141 0.37
142 0.31