Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DXX6

Protein Details
Accession C5DXX6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
29-50DSTQNYNKRNKRVERPRTQEPAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013170  mRNA_splic_Cwf21_dom  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0008380  P:RNA splicing  
KEGG zro:ZYRO0F08558g  -  
Pfam View protein in Pfam  
PF08312  cwf21  
CDD cd21372  cwf21_CWC21-like  
Amino Acid Sequences MSYNNVGLKTAKGSSTSGHIQRSLAGHNDSTQNYNKRNKRVERPRTQEPASHRPKDAKLVDHLQRREIELQVSELRDQLEDGSDDDDETIDRKCNELREKLTNATRTAYTSRKERENASEPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.29
4 0.3
5 0.3
6 0.3
7 0.28
8 0.3
9 0.31
10 0.28
11 0.25
12 0.22
13 0.2
14 0.21
15 0.25
16 0.23
17 0.25
18 0.29
19 0.32
20 0.37
21 0.46
22 0.5
23 0.54
24 0.63
25 0.67
26 0.71
27 0.76
28 0.8
29 0.81
30 0.82
31 0.82
32 0.8
33 0.73
34 0.67
35 0.63
36 0.63
37 0.6
38 0.56
39 0.49
40 0.46
41 0.45
42 0.49
43 0.44
44 0.36
45 0.32
46 0.35
47 0.4
48 0.43
49 0.42
50 0.37
51 0.35
52 0.34
53 0.32
54 0.26
55 0.21
56 0.14
57 0.16
58 0.16
59 0.16
60 0.14
61 0.13
62 0.13
63 0.11
64 0.11
65 0.09
66 0.08
67 0.07
68 0.08
69 0.08
70 0.08
71 0.08
72 0.07
73 0.07
74 0.06
75 0.07
76 0.07
77 0.09
78 0.09
79 0.11
80 0.14
81 0.21
82 0.28
83 0.34
84 0.39
85 0.43
86 0.47
87 0.52
88 0.57
89 0.54
90 0.49
91 0.45
92 0.4
93 0.37
94 0.38
95 0.37
96 0.35
97 0.39
98 0.43
99 0.48
100 0.5
101 0.52
102 0.56