Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5E1G1

Protein Details
Accession C5E1G1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
111-140LQADPMKLRKKQLRKDNREKIKQNNFLKQIHydrophilic
NLS Segment(s)
PositionSequence
117-128KLRKKQLRKDNR
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG zro:ZYRO0G20702g  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLLSTSKSFGILYYNKSELREEVYFRVSFLYSGPSSSITSLSMFQLLRLFPRRFVSTSPVLGQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWEVLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.33
4 0.34
5 0.29
6 0.31
7 0.3
8 0.27
9 0.27
10 0.3
11 0.28
12 0.27
13 0.27
14 0.21
15 0.18
16 0.15
17 0.17
18 0.13
19 0.14
20 0.14
21 0.14
22 0.15
23 0.15
24 0.15
25 0.11
26 0.11
27 0.12
28 0.11
29 0.13
30 0.12
31 0.12
32 0.13
33 0.12
34 0.16
35 0.22
36 0.23
37 0.22
38 0.26
39 0.28
40 0.27
41 0.29
42 0.3
43 0.26
44 0.27
45 0.26
46 0.24
47 0.21
48 0.2
49 0.18
50 0.15
51 0.13
52 0.11
53 0.11
54 0.09
55 0.09
56 0.09
57 0.1
58 0.07
59 0.08
60 0.09
61 0.1
62 0.18
63 0.19
64 0.19
65 0.21
66 0.21
67 0.21
68 0.21
69 0.26
70 0.19
71 0.23
72 0.24
73 0.25
74 0.3
75 0.29
76 0.3
77 0.26
78 0.26
79 0.21
80 0.2
81 0.16
82 0.11
83 0.12
84 0.1
85 0.08
86 0.06
87 0.08
88 0.09
89 0.1
90 0.1
91 0.12
92 0.13
93 0.14
94 0.14
95 0.13
96 0.15
97 0.17
98 0.24
99 0.25
100 0.31
101 0.4
102 0.5
103 0.59
104 0.59
105 0.65
106 0.68
107 0.74
108 0.77
109 0.79
110 0.8
111 0.81
112 0.89
113 0.91
114 0.92
115 0.92
116 0.91
117 0.9
118 0.9
119 0.89
120 0.87