Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5E1J6

Protein Details
Accession C5E1J6    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-25TEQISHKKSLPKVNKERRAQLKEYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12.333, mito 5, cyto 4
Family & Domain DBs
KEGG zro:ZYRO0G21516g  -  
Pfam View protein in Pfam  
PF08700  Vps51  
Amino Acid Sequences MTEQISHKKSLPKVNKERRAQLKEYYRLEEEAEEAEEHKRTEPKPNATSSHVQEDKPIEQLKFQELVHTHNRLLSKETETNNSIKNTIYENYYDLIKVNDLLKSMTGSNEKELNQLKKAVELLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.84
4 0.87
5 0.87
6 0.84
7 0.78
8 0.76
9 0.74
10 0.73
11 0.7
12 0.64
13 0.56
14 0.49
15 0.46
16 0.37
17 0.28
18 0.2
19 0.17
20 0.13
21 0.12
22 0.12
23 0.13
24 0.13
25 0.14
26 0.18
27 0.18
28 0.28
29 0.34
30 0.41
31 0.44
32 0.47
33 0.48
34 0.48
35 0.52
36 0.44
37 0.45
38 0.39
39 0.35
40 0.34
41 0.33
42 0.29
43 0.28
44 0.28
45 0.19
46 0.19
47 0.2
48 0.19
49 0.18
50 0.17
51 0.17
52 0.15
53 0.19
54 0.23
55 0.24
56 0.22
57 0.22
58 0.24
59 0.21
60 0.23
61 0.2
62 0.21
63 0.24
64 0.26
65 0.28
66 0.28
67 0.3
68 0.31
69 0.3
70 0.25
71 0.2
72 0.2
73 0.19
74 0.18
75 0.17
76 0.15
77 0.15
78 0.15
79 0.15
80 0.14
81 0.12
82 0.12
83 0.1
84 0.11
85 0.11
86 0.11
87 0.11
88 0.12
89 0.12
90 0.13
91 0.13
92 0.15
93 0.18
94 0.19
95 0.22
96 0.26
97 0.26
98 0.31
99 0.38
100 0.39
101 0.38
102 0.41
103 0.38
104 0.37
105 0.38