Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UZS4

Protein Details
Accession G4UZS4   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
80-102QYFLERKGGKRTFRPKIRRALTGHydrophilic
NLS Segment(s)
PositionSequence
67-67R
85-99RKGGKRTFRPKIRRA
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 3
Family & Domain DBs
Amino Acid Sequences MVMDGKPDRSAEFVREVSHGNEGGFGNKYGRRTEDELVLWGWEGDGTGESGEEGLVLSCAKDSGRKRRRSSGGVGITNHQYFLERKGGKRTFRPKIRRALTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.27
4 0.24
5 0.25
6 0.22
7 0.16
8 0.18
9 0.16
10 0.17
11 0.16
12 0.15
13 0.16
14 0.17
15 0.19
16 0.18
17 0.21
18 0.23
19 0.26
20 0.27
21 0.28
22 0.26
23 0.26
24 0.24
25 0.22
26 0.17
27 0.12
28 0.1
29 0.05
30 0.05
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.02
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.1
49 0.16
50 0.27
51 0.37
52 0.46
53 0.52
54 0.61
55 0.68
56 0.66
57 0.67
58 0.66
59 0.64
60 0.59
61 0.56
62 0.49
63 0.47
64 0.42
65 0.36
66 0.26
67 0.2
68 0.17
69 0.2
70 0.27
71 0.26
72 0.28
73 0.39
74 0.46
75 0.5
76 0.59
77 0.66
78 0.67
79 0.74
80 0.81
81 0.79
82 0.83