Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R2Z1

Protein Details
Accession C4R2Z1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
340-359VPANKEKPGKPQPPKKPSGLHydrophilic
NLS Segment(s)
PositionSequence
344-367KEKPGKPQPPKKPSGLSTKKPARK
Subcellular Location(s) cyto_nucl 9.666, cyto 9.5, cyto_mito 7.999, nucl 7.5, mito_nucl 6.999, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001837  Adenylate_cyclase-assoc_CAP  
IPR013912  Adenylate_cyclase-assoc_CAP_C  
IPR013992  Adenylate_cyclase-assoc_CAP_N  
IPR017901  C-CAP_CF_C-like  
IPR016098  CAP/MinC_C  
IPR036223  CAP_C_sf  
IPR028417  CAP_CS_C  
IPR018106  CAP_CS_N  
IPR036222  CAP_N_sf  
IPR006599  CARP_motif  
Gene Ontology GO:0000935  C:division septum  
GO:0035838  C:growing cell tip  
GO:0003779  F:actin binding  
GO:0007015  P:actin filament organization  
GO:0010619  P:adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway  
GO:0030308  P:negative regulation of cell growth  
GO:0031138  P:negative regulation of conjugation with cellular fusion  
KEGG ppa:PAS_chr2-2_0067  -  
Pfam View protein in Pfam  
PF08603  CAP_C  
PF01213  CAP_N  
PROSITE View protein in PROSITE  
PS51329  C_CAP_COFACTOR_C  
PS01088  CAP_1  
PS01089  CAP_2  
Amino Acid Sequences MTDALQGLNLVTLLKRLDAATTRLEDITIFQESIIQREQPFPSEILNNSESQSVQQGSSRLDSSASDFTETKIEAEKPSITAYEKLYNDHVAPFLALSKELDETLGKQVQFFANAFQEQLKLLKAVVRSRKVEITDSTFLEAVKPTNTLLREVFAIKDDNRRSEFFDNLNSVAEGAPVLGWLYVNTPVSYIPEYKDAASFWTNKVLKKFRDTDSRQVEWVKQFLGIFDALRDYAKEYHTTGASWDANGTEFKEALKSSGSPTNAPLASASAPVAGGPPPPPPPPPADVFQTDDSKGKKPQGMGAVFADLNKGEAITSGLRKVDKSEMVHKNPELRQSNVVPANKEKPGKPQPPKKPSGLSTKKPARKELQDNKWLVENYDGEQEIVIEGEMQQSVFISKCDNSTITIRGKVAAVSLTQCSKVGLVVDSLVSGIDVIKSRGFGVQVLGNVPTITIDQSDNGQIYLGAESLGTEIYASSTTSLNINVPDEDGDFREMAAPEQFKHTVAGGNLQTTVVEHVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.15
5 0.18
6 0.21
7 0.24
8 0.26
9 0.28
10 0.27
11 0.27
12 0.22
13 0.21
14 0.22
15 0.18
16 0.16
17 0.13
18 0.18
19 0.19
20 0.22
21 0.23
22 0.22
23 0.21
24 0.27
25 0.29
26 0.27
27 0.3
28 0.27
29 0.27
30 0.29
31 0.29
32 0.29
33 0.3
34 0.28
35 0.26
36 0.27
37 0.23
38 0.2
39 0.23
40 0.18
41 0.17
42 0.19
43 0.2
44 0.21
45 0.24
46 0.24
47 0.2
48 0.19
49 0.19
50 0.2
51 0.23
52 0.21
53 0.21
54 0.2
55 0.21
56 0.24
57 0.24
58 0.2
59 0.2
60 0.21
61 0.19
62 0.22
63 0.23
64 0.2
65 0.22
66 0.23
67 0.2
68 0.22
69 0.24
70 0.28
71 0.28
72 0.29
73 0.3
74 0.3
75 0.29
76 0.27
77 0.24
78 0.16
79 0.16
80 0.13
81 0.13
82 0.11
83 0.11
84 0.1
85 0.11
86 0.11
87 0.11
88 0.12
89 0.1
90 0.12
91 0.17
92 0.21
93 0.19
94 0.19
95 0.21
96 0.21
97 0.23
98 0.21
99 0.18
100 0.17
101 0.18
102 0.18
103 0.16
104 0.16
105 0.14
106 0.16
107 0.13
108 0.1
109 0.1
110 0.13
111 0.16
112 0.23
113 0.31
114 0.37
115 0.38
116 0.41
117 0.45
118 0.44
119 0.44
120 0.4
121 0.38
122 0.35
123 0.33
124 0.31
125 0.27
126 0.25
127 0.23
128 0.2
129 0.14
130 0.11
131 0.11
132 0.1
133 0.14
134 0.15
135 0.16
136 0.16
137 0.15
138 0.16
139 0.16
140 0.16
141 0.14
142 0.17
143 0.16
144 0.24
145 0.26
146 0.29
147 0.32
148 0.32
149 0.36
150 0.35
151 0.37
152 0.3
153 0.31
154 0.29
155 0.26
156 0.25
157 0.2
158 0.17
159 0.14
160 0.12
161 0.08
162 0.05
163 0.04
164 0.04
165 0.04
166 0.03
167 0.03
168 0.04
169 0.05
170 0.07
171 0.08
172 0.08
173 0.08
174 0.09
175 0.11
176 0.12
177 0.12
178 0.11
179 0.14
180 0.15
181 0.15
182 0.15
183 0.14
184 0.15
185 0.17
186 0.17
187 0.15
188 0.23
189 0.25
190 0.27
191 0.34
192 0.37
193 0.38
194 0.42
195 0.47
196 0.43
197 0.51
198 0.54
199 0.56
200 0.57
201 0.56
202 0.51
203 0.48
204 0.47
205 0.38
206 0.34
207 0.25
208 0.18
209 0.17
210 0.15
211 0.14
212 0.11
213 0.09
214 0.08
215 0.08
216 0.07
217 0.07
218 0.07
219 0.07
220 0.09
221 0.1
222 0.12
223 0.12
224 0.13
225 0.14
226 0.14
227 0.12
228 0.14
229 0.14
230 0.12
231 0.11
232 0.1
233 0.1
234 0.1
235 0.11
236 0.07
237 0.07
238 0.07
239 0.08
240 0.08
241 0.08
242 0.09
243 0.08
244 0.1
245 0.14
246 0.15
247 0.14
248 0.15
249 0.18
250 0.17
251 0.17
252 0.14
253 0.11
254 0.11
255 0.11
256 0.1
257 0.06
258 0.06
259 0.06
260 0.06
261 0.05
262 0.05
263 0.06
264 0.08
265 0.11
266 0.12
267 0.14
268 0.15
269 0.18
270 0.2
271 0.22
272 0.22
273 0.22
274 0.23
275 0.25
276 0.26
277 0.25
278 0.23
279 0.24
280 0.24
281 0.25
282 0.26
283 0.26
284 0.26
285 0.24
286 0.28
287 0.32
288 0.3
289 0.29
290 0.26
291 0.24
292 0.22
293 0.21
294 0.17
295 0.09
296 0.09
297 0.07
298 0.06
299 0.04
300 0.04
301 0.06
302 0.08
303 0.09
304 0.1
305 0.12
306 0.12
307 0.13
308 0.15
309 0.18
310 0.2
311 0.22
312 0.31
313 0.38
314 0.42
315 0.46
316 0.44
317 0.47
318 0.45
319 0.51
320 0.45
321 0.39
322 0.39
323 0.37
324 0.42
325 0.41
326 0.41
327 0.34
328 0.35
329 0.37
330 0.38
331 0.4
332 0.34
333 0.38
334 0.46
335 0.54
336 0.6
337 0.66
338 0.71
339 0.77
340 0.81
341 0.76
342 0.73
343 0.68
344 0.69
345 0.68
346 0.63
347 0.63
348 0.69
349 0.7
350 0.67
351 0.69
352 0.65
353 0.65
354 0.71
355 0.71
356 0.71
357 0.72
358 0.7
359 0.64
360 0.61
361 0.52
362 0.42
363 0.35
364 0.27
365 0.2
366 0.22
367 0.21
368 0.16
369 0.15
370 0.15
371 0.11
372 0.1
373 0.08
374 0.04
375 0.04
376 0.05
377 0.05
378 0.05
379 0.05
380 0.05
381 0.06
382 0.06
383 0.07
384 0.08
385 0.09
386 0.1
387 0.13
388 0.14
389 0.15
390 0.18
391 0.24
392 0.25
393 0.27
394 0.26
395 0.25
396 0.25
397 0.22
398 0.2
399 0.16
400 0.13
401 0.12
402 0.14
403 0.15
404 0.15
405 0.15
406 0.14
407 0.13
408 0.13
409 0.12
410 0.1
411 0.09
412 0.09
413 0.09
414 0.09
415 0.08
416 0.07
417 0.06
418 0.05
419 0.05
420 0.06
421 0.07
422 0.09
423 0.09
424 0.1
425 0.11
426 0.13
427 0.13
428 0.12
429 0.13
430 0.15
431 0.15
432 0.16
433 0.16
434 0.14
435 0.14
436 0.13
437 0.11
438 0.09
439 0.08
440 0.09
441 0.09
442 0.09
443 0.11
444 0.14
445 0.14
446 0.13
447 0.12
448 0.11
449 0.11
450 0.11
451 0.09
452 0.06
453 0.06
454 0.06
455 0.07
456 0.06
457 0.05
458 0.04
459 0.04
460 0.06
461 0.06
462 0.06
463 0.07
464 0.08
465 0.09
466 0.1
467 0.11
468 0.12
469 0.14
470 0.15
471 0.14
472 0.15
473 0.15
474 0.16
475 0.17
476 0.17
477 0.17
478 0.15
479 0.15
480 0.18
481 0.17
482 0.18
483 0.22
484 0.22
485 0.21
486 0.27
487 0.28
488 0.24
489 0.26
490 0.25
491 0.23
492 0.22
493 0.29
494 0.24
495 0.25
496 0.25
497 0.23
498 0.22
499 0.18