Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UH85

Protein Details
Accession G4UH85   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
40-66GSRFFVQRNRGRKKRQRSSGVQKDWKSHydrophilic
NLS Segment(s)
PositionSequence
48-56NRGRKKRQR
Subcellular Location(s) mito 20, nucl 5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences GRPYTQQSRSKVTILVQSIGLHRRPHSRDHNDNICLKWVGSRFFVQRNRGRKKRQRSSGVQKDWKSHSRYLRGWQLYITYICISSESNGRRRRDHLSIVSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.28
4 0.26
5 0.28
6 0.3
7 0.3
8 0.26
9 0.26
10 0.33
11 0.34
12 0.41
13 0.48
14 0.53
15 0.58
16 0.64
17 0.69
18 0.65
19 0.65
20 0.57
21 0.5
22 0.41
23 0.33
24 0.28
25 0.22
26 0.2
27 0.19
28 0.21
29 0.21
30 0.28
31 0.33
32 0.37
33 0.42
34 0.5
35 0.57
36 0.63
37 0.71
38 0.72
39 0.78
40 0.8
41 0.83
42 0.81
43 0.81
44 0.84
45 0.85
46 0.85
47 0.82
48 0.75
49 0.7
50 0.68
51 0.65
52 0.59
53 0.54
54 0.52
55 0.52
56 0.53
57 0.55
58 0.58
59 0.54
60 0.5
61 0.44
62 0.38
63 0.33
64 0.3
65 0.25
66 0.16
67 0.14
68 0.14
69 0.14
70 0.13
71 0.12
72 0.19
73 0.22
74 0.3
75 0.38
76 0.42
77 0.46
78 0.49
79 0.56
80 0.55
81 0.58