Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UB71

Protein Details
Accession G4UB71   
Localization Confidence High
Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-38YDDNRSRSPTPRRHRSLTPRSARDYSHydrophilic
311-331SYDSYDRRSRSRSRSRDWDRRHydrophilic
NLS Segment(s)
PositionSequence
54-86RERGRSPPRRNGGGGGGRSLSPPPARARSYSRG
197-307TARRGANYDPRQPPPGSRGGGRGGRNRSPGPRGGGRHAHRSDTYRPRSLSRSRSRSRSPVAASGGNRRYRSRSRSWSSRSRSPSPRGGRGGRGGGGRGGRNDVDDRGRRSP
318-325RSRSRSRS
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR034201  RNPS1_RRM  
IPR000504  RRM_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12365  RRM_RNPS1  
Amino Acid Sequences MASRSRSRSADRYDDNRSRSPTPRRHRSLTPRSARDYSREPSPALRDRDASFDRERGRSPPRRNGGGGGGRSLSPPPARARSYSRGGDSRSRSRSLTRSPSPLQPVRSTKIVVERLTKNINENHLREIFGQFGEIEDLDLPLNRTSRTNRGTAYILYVHEAGAEAAIAHMHEAQLDGAVINVSIVLPRRKFSPSPPTARRGANYDPRQPPPGSRGGGRGGRNRSPGPRGGGRHAHRSDTYRPRSLSRSRSRSRSPVAASGGNRRYRSRSRSWSSRSRSPSPRGGRGGRGGGGRGGRNDVDDRGRRSPSRASYDSYDRRSRSRSRSRDWDRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.7
3 0.69
4 0.66
5 0.63
6 0.64
7 0.68
8 0.68
9 0.72
10 0.77
11 0.78
12 0.79
13 0.83
14 0.85
15 0.85
16 0.85
17 0.85
18 0.81
19 0.8
20 0.79
21 0.72
22 0.67
23 0.63
24 0.55
25 0.53
26 0.49
27 0.43
28 0.43
29 0.49
30 0.5
31 0.49
32 0.49
33 0.44
34 0.43
35 0.49
36 0.46
37 0.43
38 0.38
39 0.39
40 0.41
41 0.4
42 0.41
43 0.4
44 0.48
45 0.52
46 0.58
47 0.61
48 0.64
49 0.66
50 0.66
51 0.62
52 0.6
53 0.58
54 0.5
55 0.42
56 0.35
57 0.3
58 0.3
59 0.27
60 0.23
61 0.16
62 0.19
63 0.23
64 0.28
65 0.3
66 0.33
67 0.4
68 0.42
69 0.47
70 0.47
71 0.46
72 0.44
73 0.46
74 0.51
75 0.5
76 0.53
77 0.51
78 0.5
79 0.47
80 0.47
81 0.5
82 0.51
83 0.53
84 0.49
85 0.51
86 0.51
87 0.56
88 0.59
89 0.56
90 0.52
91 0.5
92 0.5
93 0.46
94 0.46
95 0.4
96 0.34
97 0.38
98 0.39
99 0.35
100 0.36
101 0.35
102 0.37
103 0.4
104 0.38
105 0.34
106 0.32
107 0.36
108 0.35
109 0.34
110 0.35
111 0.32
112 0.33
113 0.3
114 0.28
115 0.22
116 0.16
117 0.15
118 0.1
119 0.09
120 0.08
121 0.07
122 0.06
123 0.05
124 0.05
125 0.05
126 0.06
127 0.07
128 0.07
129 0.09
130 0.09
131 0.11
132 0.14
133 0.22
134 0.24
135 0.25
136 0.24
137 0.26
138 0.27
139 0.25
140 0.24
141 0.18
142 0.16
143 0.15
144 0.14
145 0.11
146 0.09
147 0.09
148 0.06
149 0.04
150 0.04
151 0.03
152 0.02
153 0.03
154 0.02
155 0.02
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.04
163 0.03
164 0.03
165 0.03
166 0.03
167 0.02
168 0.02
169 0.02
170 0.03
171 0.06
172 0.1
173 0.1
174 0.11
175 0.14
176 0.18
177 0.19
178 0.25
179 0.33
180 0.37
181 0.46
182 0.5
183 0.52
184 0.53
185 0.53
186 0.48
187 0.43
188 0.43
189 0.43
190 0.44
191 0.49
192 0.5
193 0.51
194 0.54
195 0.49
196 0.45
197 0.39
198 0.4
199 0.33
200 0.29
201 0.29
202 0.3
203 0.36
204 0.38
205 0.41
206 0.4
207 0.43
208 0.46
209 0.46
210 0.45
211 0.43
212 0.43
213 0.41
214 0.42
215 0.41
216 0.43
217 0.49
218 0.47
219 0.53
220 0.51
221 0.49
222 0.45
223 0.47
224 0.5
225 0.51
226 0.54
227 0.51
228 0.51
229 0.51
230 0.56
231 0.59
232 0.6
233 0.6
234 0.64
235 0.64
236 0.7
237 0.73
238 0.74
239 0.72
240 0.69
241 0.62
242 0.58
243 0.55
244 0.53
245 0.48
246 0.5
247 0.52
248 0.5
249 0.49
250 0.46
251 0.49
252 0.53
253 0.57
254 0.58
255 0.61
256 0.63
257 0.71
258 0.76
259 0.79
260 0.78
261 0.8
262 0.78
263 0.77
264 0.77
265 0.73
266 0.75
267 0.73
268 0.74
269 0.72
270 0.69
271 0.66
272 0.62
273 0.59
274 0.53
275 0.46
276 0.39
277 0.35
278 0.35
279 0.32
280 0.28
281 0.28
282 0.25
283 0.26
284 0.27
285 0.28
286 0.32
287 0.36
288 0.41
289 0.43
290 0.49
291 0.48
292 0.5
293 0.55
294 0.55
295 0.57
296 0.54
297 0.53
298 0.53
299 0.62
300 0.66
301 0.65
302 0.65
303 0.59
304 0.63
305 0.65
306 0.68
307 0.68
308 0.71
309 0.73
310 0.73
311 0.81