Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UTK2

Protein Details
Accession G4UTK2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-82LRAVPKKKTSHMKKRHRQMAGKBasic
NLS Segment(s)
PositionSequence
65-78PKKKTSHMKKRHRQ
Subcellular Location(s) mito 18.5, cyto_mito 10.333, extr 3, plas 2, cyto_nucl 1.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAMTAAAAPAMRLFNPSTFFQTLRTQRFGVPALNFAVPAAAISLLPSIPSLLEDIWEGILRAVPKKKTSHMKKRHRQMAGKALKDVTHLNRCPACGNLKRMHHLCSTCLGKLKGFMDRNGGSNAKAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.18
4 0.2
5 0.24
6 0.25
7 0.25
8 0.27
9 0.34
10 0.4
11 0.42
12 0.44
13 0.39
14 0.38
15 0.42
16 0.4
17 0.35
18 0.28
19 0.25
20 0.23
21 0.22
22 0.2
23 0.16
24 0.14
25 0.09
26 0.08
27 0.06
28 0.04
29 0.03
30 0.04
31 0.05
32 0.04
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.05
39 0.04
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.05
46 0.05
47 0.06
48 0.06
49 0.09
50 0.13
51 0.15
52 0.18
53 0.21
54 0.27
55 0.36
56 0.46
57 0.54
58 0.61
59 0.71
60 0.76
61 0.84
62 0.87
63 0.84
64 0.8
65 0.76
66 0.76
67 0.73
68 0.66
69 0.57
70 0.49
71 0.42
72 0.38
73 0.35
74 0.31
75 0.31
76 0.3
77 0.34
78 0.34
79 0.35
80 0.34
81 0.33
82 0.34
83 0.32
84 0.37
85 0.39
86 0.43
87 0.49
88 0.5
89 0.51
90 0.49
91 0.45
92 0.4
93 0.4
94 0.4
95 0.35
96 0.39
97 0.36
98 0.31
99 0.35
100 0.35
101 0.37
102 0.36
103 0.36
104 0.37
105 0.38
106 0.39
107 0.4
108 0.38