Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UF09

Protein Details
Accession G4UF09    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSVAREPKPKLKPKPVIERDSKPHydrophilic
NLS Segment(s)
PositionSequence
7-16PKPKLKPKPV
Subcellular Location(s) nucl 10, mito 7, cyto 6, pero 4
Family & Domain DBs
Amino Acid Sequences MSVAREPKPKLKPKPVIERDSKPIKDAKFQPASMKPWAPHNLCLRYPGPKIQTTKDLEACPPAFKVGGKDAKLEPQPGKGVKKGWQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.85
4 0.83
5 0.78
6 0.75
7 0.75
8 0.66
9 0.57
10 0.54
11 0.47
12 0.48
13 0.47
14 0.48
15 0.44
16 0.45
17 0.49
18 0.48
19 0.5
20 0.46
21 0.43
22 0.35
23 0.36
24 0.42
25 0.37
26 0.38
27 0.4
28 0.41
29 0.38
30 0.41
31 0.35
32 0.33
33 0.32
34 0.31
35 0.28
36 0.29
37 0.32
38 0.31
39 0.37
40 0.37
41 0.4
42 0.39
43 0.36
44 0.32
45 0.35
46 0.33
47 0.27
48 0.23
49 0.19
50 0.16
51 0.15
52 0.18
53 0.21
54 0.27
55 0.27
56 0.3
57 0.3
58 0.37
59 0.4
60 0.42
61 0.36
62 0.34
63 0.39
64 0.42
65 0.46
66 0.43
67 0.44