Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UXS3

Protein Details
Accession G4UXS3    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
2-21PKKGSNGQPKPNRQPARVKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto_nucl 4.5, cyto 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MPKKGSNGQPKPNRQPARVKVFENGSFSNFEFISQQGSHLVSASLVSIAGASLPSIRITLTLAKRTSSSRVGNWVTPPTLPICRFLILKRVYNSYINRVDVGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.79
4 0.79
5 0.74
6 0.66
7 0.61
8 0.6
9 0.57
10 0.52
11 0.44
12 0.35
13 0.32
14 0.3
15 0.27
16 0.21
17 0.17
18 0.13
19 0.12
20 0.15
21 0.12
22 0.13
23 0.12
24 0.13
25 0.12
26 0.11
27 0.11
28 0.07
29 0.07
30 0.06
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.02
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.06
46 0.12
47 0.15
48 0.2
49 0.2
50 0.21
51 0.23
52 0.24
53 0.27
54 0.27
55 0.27
56 0.24
57 0.31
58 0.33
59 0.34
60 0.35
61 0.34
62 0.28
63 0.25
64 0.25
65 0.21
66 0.25
67 0.23
68 0.23
69 0.23
70 0.24
71 0.26
72 0.26
73 0.32
74 0.3
75 0.36
76 0.36
77 0.39
78 0.4
79 0.45
80 0.48
81 0.47
82 0.48
83 0.43