Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4UVM7

Protein Details
Accession G4UVM7    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
56-82ESQRRWLHYQMKFRRRRAKPLPGVQDQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAQGSLQISNLSLRFFSPSEMRRLPSRIVVCDVRKRREGRVPLDTSTSQPVRSLHESQRRWLHYQMKFRRRRAKPLPGVQDQPIDRYSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.17
4 0.21
5 0.23
6 0.3
7 0.32
8 0.34
9 0.35
10 0.38
11 0.37
12 0.37
13 0.37
14 0.31
15 0.33
16 0.37
17 0.38
18 0.44
19 0.49
20 0.46
21 0.5
22 0.5
23 0.51
24 0.53
25 0.55
26 0.51
27 0.53
28 0.52
29 0.46
30 0.47
31 0.42
32 0.35
33 0.33
34 0.28
35 0.19
36 0.18
37 0.18
38 0.19
39 0.23
40 0.27
41 0.31
42 0.4
43 0.41
44 0.45
45 0.52
46 0.51
47 0.5
48 0.52
49 0.53
50 0.51
51 0.6
52 0.65
53 0.67
54 0.73
55 0.78
56 0.82
57 0.79
58 0.83
59 0.82
60 0.83
61 0.82
62 0.83
63 0.83
64 0.79
65 0.78
66 0.7
67 0.68
68 0.57
69 0.51