Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4V1G1

Protein Details
Accession G4V1G1    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
284-303DQELRPKKPEELRRKQRGVTBasic
NLS Segment(s)
PositionSequence
289-300PKKPEELRRKQR
Subcellular Location(s) mito 17.5, cyto_mito 12, cyto 5.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009737  Aim32/Apd1-like  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF06999  Suc_Fer-like  
CDD cd03062  TRX_Fd_Sucrase  
Amino Acid Sequences MFRSLLSSAKSLAIGDSGNKATKPEDLFPVVSKEVDGDDCDHDCATCTITYPRSFKIDEEDKLFGLIKGWATHVLVATGKTDWVRDVADEKGSVMQAIAGAKAPANGKLMLSASNIPTPHHPPSYSEPTTLLLLPAFILIENVTPATVPLVLEKIISQAPTNSTPLAPFSLPRSLEAPLPEASPAYIKELTTRPCPHQALILLCSQKTRDARCGQSAPLLRKELQRHLQPLGLYRDLDDERPGGVGIYFISHVGGHKYSANMLVYRRPDAFGLDHVERAKAEGDQELRPKKPEELRRKQRGVTKEGEEGKGQEEEEEENGEVGAAQCIWLARVKPEDCEGIVKFTVLQGKVIKPQSQLRGGFDRQRGVLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.17
4 0.18
5 0.2
6 0.2
7 0.21
8 0.21
9 0.26
10 0.29
11 0.28
12 0.31
13 0.33
14 0.34
15 0.35
16 0.39
17 0.34
18 0.29
19 0.25
20 0.2
21 0.18
22 0.18
23 0.17
24 0.15
25 0.17
26 0.18
27 0.19
28 0.18
29 0.16
30 0.17
31 0.16
32 0.15
33 0.12
34 0.13
35 0.16
36 0.22
37 0.28
38 0.3
39 0.32
40 0.34
41 0.35
42 0.34
43 0.38
44 0.4
45 0.38
46 0.4
47 0.39
48 0.34
49 0.35
50 0.35
51 0.25
52 0.19
53 0.18
54 0.14
55 0.13
56 0.14
57 0.15
58 0.14
59 0.15
60 0.14
61 0.14
62 0.13
63 0.12
64 0.12
65 0.11
66 0.12
67 0.11
68 0.11
69 0.1
70 0.11
71 0.11
72 0.11
73 0.13
74 0.13
75 0.15
76 0.14
77 0.14
78 0.15
79 0.14
80 0.13
81 0.1
82 0.09
83 0.08
84 0.09
85 0.08
86 0.07
87 0.07
88 0.07
89 0.1
90 0.11
91 0.11
92 0.13
93 0.13
94 0.12
95 0.14
96 0.14
97 0.13
98 0.14
99 0.14
100 0.14
101 0.16
102 0.17
103 0.16
104 0.19
105 0.23
106 0.25
107 0.26
108 0.25
109 0.26
110 0.33
111 0.42
112 0.39
113 0.35
114 0.32
115 0.3
116 0.31
117 0.27
118 0.2
119 0.11
120 0.09
121 0.08
122 0.07
123 0.06
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.05
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.08
143 0.08
144 0.08
145 0.08
146 0.11
147 0.13
148 0.14
149 0.13
150 0.12
151 0.12
152 0.13
153 0.13
154 0.11
155 0.1
156 0.11
157 0.15
158 0.16
159 0.16
160 0.17
161 0.16
162 0.17
163 0.17
164 0.17
165 0.13
166 0.13
167 0.12
168 0.1
169 0.09
170 0.09
171 0.08
172 0.1
173 0.1
174 0.09
175 0.12
176 0.16
177 0.19
178 0.24
179 0.27
180 0.26
181 0.32
182 0.33
183 0.3
184 0.3
185 0.3
186 0.25
187 0.24
188 0.25
189 0.19
190 0.18
191 0.19
192 0.16
193 0.19
194 0.2
195 0.21
196 0.25
197 0.29
198 0.32
199 0.37
200 0.39
201 0.34
202 0.37
203 0.39
204 0.35
205 0.34
206 0.34
207 0.31
208 0.35
209 0.38
210 0.4
211 0.42
212 0.43
213 0.41
214 0.4
215 0.41
216 0.36
217 0.37
218 0.34
219 0.29
220 0.24
221 0.21
222 0.24
223 0.22
224 0.22
225 0.18
226 0.13
227 0.12
228 0.12
229 0.12
230 0.08
231 0.07
232 0.06
233 0.05
234 0.05
235 0.05
236 0.05
237 0.06
238 0.06
239 0.06
240 0.09
241 0.09
242 0.09
243 0.1
244 0.11
245 0.11
246 0.14
247 0.15
248 0.14
249 0.15
250 0.2
251 0.21
252 0.24
253 0.24
254 0.22
255 0.21
256 0.21
257 0.21
258 0.18
259 0.22
260 0.2
261 0.22
262 0.22
263 0.22
264 0.2
265 0.2
266 0.18
267 0.12
268 0.12
269 0.14
270 0.17
271 0.21
272 0.29
273 0.34
274 0.35
275 0.37
276 0.38
277 0.41
278 0.47
279 0.53
280 0.56
281 0.61
282 0.71
283 0.78
284 0.81
285 0.8
286 0.79
287 0.76
288 0.71
289 0.66
290 0.6
291 0.57
292 0.57
293 0.53
294 0.47
295 0.4
296 0.36
297 0.31
298 0.27
299 0.19
300 0.16
301 0.15
302 0.15
303 0.16
304 0.13
305 0.12
306 0.11
307 0.11
308 0.09
309 0.08
310 0.08
311 0.05
312 0.05
313 0.06
314 0.06
315 0.07
316 0.1
317 0.11
318 0.14
319 0.23
320 0.24
321 0.26
322 0.29
323 0.31
324 0.29
325 0.34
326 0.31
327 0.28
328 0.27
329 0.25
330 0.22
331 0.22
332 0.27
333 0.22
334 0.25
335 0.25
336 0.28
337 0.36
338 0.42
339 0.43
340 0.42
341 0.49
342 0.53
343 0.56
344 0.56
345 0.54
346 0.56
347 0.58
348 0.61
349 0.58
350 0.55
351 0.48