Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4UH56

Protein Details
Accession G4UH56    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
159-200VVKKPATKKPATKKPATKKPATKKPATKKPATKKSATKKPAVHydrophilic
NLS Segment(s)
PositionSequence
161-198KKPATKKPATKKPATKKPATKKPATKKPATKKSATKKP
Subcellular Location(s) cyto 17, mito 8
Family & Domain DBs
Amino Acid Sequences MAEEGSSSPLSSVLSSPPVSPPRSVSGDWNAIHAQEIDTAARVVLEEIAAEESTVEEPAVEEPAVEDPAVKEPAVEDPAVKEPAVEEPAVEDPAVKEPAVEDPAVKEPAVEELAVEEPAVEEPTVEEPTVEEPTVEEPAVEESTVEEPAVEEHTVEELVVKKPATKKPATKKPATKKPATKKPATKKPATKKSATKKPAVEQGHVKERTGHAVGGIKCLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.24
5 0.29
6 0.3
7 0.31
8 0.32
9 0.33
10 0.37
11 0.37
12 0.36
13 0.37
14 0.41
15 0.4
16 0.4
17 0.34
18 0.29
19 0.29
20 0.24
21 0.18
22 0.12
23 0.14
24 0.1
25 0.11
26 0.11
27 0.09
28 0.09
29 0.08
30 0.07
31 0.06
32 0.05
33 0.04
34 0.05
35 0.06
36 0.06
37 0.06
38 0.05
39 0.06
40 0.07
41 0.07
42 0.06
43 0.04
44 0.05
45 0.06
46 0.07
47 0.06
48 0.06
49 0.06
50 0.08
51 0.08
52 0.08
53 0.07
54 0.07
55 0.11
56 0.12
57 0.11
58 0.09
59 0.09
60 0.13
61 0.14
62 0.13
63 0.1
64 0.11
65 0.15
66 0.16
67 0.15
68 0.12
69 0.11
70 0.13
71 0.15
72 0.12
73 0.09
74 0.09
75 0.11
76 0.12
77 0.11
78 0.09
79 0.08
80 0.12
81 0.13
82 0.11
83 0.09
84 0.09
85 0.13
86 0.14
87 0.13
88 0.1
89 0.11
90 0.15
91 0.16
92 0.15
93 0.12
94 0.1
95 0.12
96 0.12
97 0.1
98 0.06
99 0.06
100 0.07
101 0.07
102 0.06
103 0.05
104 0.04
105 0.05
106 0.05
107 0.04
108 0.03
109 0.04
110 0.06
111 0.07
112 0.07
113 0.07
114 0.07
115 0.09
116 0.1
117 0.1
118 0.07
119 0.07
120 0.09
121 0.1
122 0.1
123 0.07
124 0.06
125 0.09
126 0.09
127 0.08
128 0.07
129 0.07
130 0.08
131 0.09
132 0.08
133 0.06
134 0.06
135 0.07
136 0.09
137 0.07
138 0.06
139 0.06
140 0.07
141 0.07
142 0.07
143 0.08
144 0.08
145 0.09
146 0.12
147 0.12
148 0.15
149 0.22
150 0.28
151 0.34
152 0.39
153 0.48
154 0.56
155 0.67
156 0.71
157 0.73
158 0.78
159 0.82
160 0.85
161 0.83
162 0.82
163 0.82
164 0.85
165 0.86
166 0.83
167 0.82
168 0.82
169 0.85
170 0.86
171 0.83
172 0.82
173 0.82
174 0.86
175 0.87
176 0.83
177 0.8
178 0.8
179 0.83
180 0.85
181 0.8
182 0.77
183 0.73
184 0.73
185 0.75
186 0.69
187 0.64
188 0.62
189 0.64
190 0.66
191 0.6
192 0.54
193 0.5
194 0.47
195 0.48
196 0.41
197 0.33
198 0.27
199 0.33
200 0.32