Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4U735

Protein Details
Accession G4U735    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
169-194TDRTDRARSDRPNHRRGRGRGARLNQBasic
NLS Segment(s)
PositionSequence
176-191RSDRPNHRRGRGRGAR
Subcellular Location(s) nucl 19, cyto 4, pero 1, golg 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR024771  SUZ  
PROSITE View protein in PROSITE  
PS51673  SUZ  
Amino Acid Sequences MGKNDSVPDAWDDDWESLADRAAKEAPSPEPKKEVKMTKAERLAMHVEAQRKLWETAESEKEINFLAATSSVPLTTPFKPAMKVLSRRPVIAKRDPVTGLERLTLQDDEDDDESKNKKQETPEEIRMRQQRELEEKQRRYDEARAKIFGESSPSSGLSTPGSVTPPKETDRTDRARSDRPNHRRGRGRGARLNQPEAVGRGLSER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.12
5 0.14
6 0.15
7 0.13
8 0.15
9 0.17
10 0.17
11 0.17
12 0.19
13 0.24
14 0.32
15 0.35
16 0.36
17 0.42
18 0.43
19 0.48
20 0.54
21 0.55
22 0.52
23 0.58
24 0.61
25 0.62
26 0.66
27 0.63
28 0.56
29 0.51
30 0.48
31 0.38
32 0.37
33 0.31
34 0.3
35 0.27
36 0.28
37 0.26
38 0.25
39 0.25
40 0.22
41 0.2
42 0.19
43 0.24
44 0.27
45 0.27
46 0.25
47 0.24
48 0.24
49 0.22
50 0.19
51 0.12
52 0.08
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.08
61 0.11
62 0.11
63 0.14
64 0.16
65 0.16
66 0.17
67 0.18
68 0.23
69 0.26
70 0.31
71 0.34
72 0.41
73 0.4
74 0.41
75 0.44
76 0.45
77 0.44
78 0.45
79 0.47
80 0.39
81 0.41
82 0.41
83 0.38
84 0.34
85 0.3
86 0.24
87 0.17
88 0.16
89 0.13
90 0.14
91 0.12
92 0.09
93 0.08
94 0.07
95 0.08
96 0.09
97 0.09
98 0.08
99 0.11
100 0.13
101 0.15
102 0.17
103 0.17
104 0.19
105 0.22
106 0.29
107 0.35
108 0.41
109 0.48
110 0.52
111 0.53
112 0.57
113 0.59
114 0.55
115 0.51
116 0.45
117 0.41
118 0.42
119 0.49
120 0.51
121 0.56
122 0.56
123 0.57
124 0.57
125 0.54
126 0.5
127 0.51
128 0.5
129 0.49
130 0.5
131 0.46
132 0.44
133 0.43
134 0.4
135 0.31
136 0.28
137 0.2
138 0.18
139 0.17
140 0.17
141 0.17
142 0.17
143 0.17
144 0.12
145 0.12
146 0.11
147 0.11
148 0.13
149 0.14
150 0.15
151 0.18
152 0.21
153 0.24
154 0.27
155 0.29
156 0.34
157 0.41
158 0.47
159 0.49
160 0.53
161 0.56
162 0.61
163 0.67
164 0.69
165 0.71
166 0.73
167 0.77
168 0.78
169 0.82
170 0.83
171 0.8
172 0.82
173 0.81
174 0.81
175 0.8
176 0.78
177 0.79
178 0.76
179 0.75
180 0.65
181 0.57
182 0.5
183 0.42
184 0.38
185 0.27