Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UGV1

Protein Details
Accession G4UGV1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPITKKSAKGKGPKVTKKFVHydrophilic
NLS Segment(s)
PositionSequence
7-15KSAKGKGPK
Subcellular Location(s) cyto_mito 10.166, mito 10, cyto 10, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPITKKSAKGKGPKVTKKFVINASQPASDKIFDVSAFEKFLTEKIKVEGRVGNLGETIKISQVGDGKIEIVAHNELSGRYLKYLTKKFLKKMQLRDWLRVVSTSRGVYELKFFNVVNDEAEEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.8
4 0.78
5 0.74
6 0.7
7 0.67
8 0.65
9 0.59
10 0.58
11 0.54
12 0.51
13 0.44
14 0.41
15 0.36
16 0.28
17 0.24
18 0.19
19 0.16
20 0.13
21 0.14
22 0.13
23 0.12
24 0.13
25 0.12
26 0.11
27 0.1
28 0.13
29 0.14
30 0.14
31 0.14
32 0.16
33 0.2
34 0.2
35 0.22
36 0.22
37 0.21
38 0.23
39 0.22
40 0.2
41 0.16
42 0.16
43 0.13
44 0.11
45 0.1
46 0.06
47 0.06
48 0.06
49 0.07
50 0.09
51 0.09
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.1
66 0.08
67 0.09
68 0.1
69 0.13
70 0.21
71 0.26
72 0.31
73 0.39
74 0.44
75 0.48
76 0.55
77 0.62
78 0.62
79 0.67
80 0.7
81 0.71
82 0.69
83 0.7
84 0.66
85 0.58
86 0.5
87 0.44
88 0.37
89 0.3
90 0.31
91 0.26
92 0.23
93 0.23
94 0.23
95 0.21
96 0.24
97 0.22
98 0.2
99 0.22
100 0.21
101 0.21
102 0.24
103 0.24
104 0.2
105 0.19
106 0.18