Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0US38

Protein Details
Accession Q0US38   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-38IFTVPAIRRARKRPNKRGRTSIRFPTRFHydrophilic
NLS Segment(s)
PositionSequence
18-30RRARKRPNKRGRT
Subcellular Location(s) mito 17, nucl 5, cyto 4
Family & Domain DBs
KEGG pno:SNOG_05426  -  
Amino Acid Sequences MAPLVRFCNGIFTVPAIRRARKRPNKRGRTSIRFPTRFISKIYGTPAVLYIWLFEAPRLPHTQPHPPNPHHVTEMVAIAVGDCQLNTSRRILAEIQLRINGFNTYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.34
3 0.33
4 0.39
5 0.44
6 0.53
7 0.62
8 0.66
9 0.76
10 0.78
11 0.85
12 0.89
13 0.9
14 0.91
15 0.9
16 0.88
17 0.85
18 0.84
19 0.83
20 0.74
21 0.68
22 0.62
23 0.57
24 0.49
25 0.44
26 0.38
27 0.29
28 0.29
29 0.31
30 0.28
31 0.23
32 0.21
33 0.2
34 0.15
35 0.13
36 0.11
37 0.07
38 0.06
39 0.06
40 0.06
41 0.05
42 0.08
43 0.08
44 0.11
45 0.14
46 0.14
47 0.18
48 0.22
49 0.32
50 0.35
51 0.43
52 0.49
53 0.48
54 0.55
55 0.55
56 0.54
57 0.46
58 0.4
59 0.33
60 0.26
61 0.25
62 0.16
63 0.12
64 0.1
65 0.08
66 0.07
67 0.06
68 0.04
69 0.03
70 0.05
71 0.08
72 0.1
73 0.12
74 0.14
75 0.16
76 0.17
77 0.2
78 0.2
79 0.23
80 0.29
81 0.31
82 0.32
83 0.33
84 0.33
85 0.31
86 0.31