FuNGI

G4V1T8

Protein Details

Accession

G4V1T8

Localization Confidence

Medium

Confidence Score

10.3

NoLS Segment(s)

Position	Sequence	Protein Nature
81-102	SATSSHPPSKRQRPNNDQLSEG	Hydrophilic
498-519	SEEGDKKKSSEKRRSNVPAGSG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 12, mito 10, cyto_nucl 9.5, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR041723 CCT IPR004821 Cyt_trans-like IPR045049 Pcy1-like IPR014729 Rossmann-like_a/b/a_fold
Gene Ontology	GO:0004105 F:choline-phosphate cytidylyltransferase activity
Pfam	View protein in Pfam PF01467 CTP_transf_like
CDD	cd02174 CCT

Amino Acid Sequences

MSPSLNSSTPQASGKRKRSSAAADSIANSKINTTHLDPVDAAIMNQDQIIQTESRDASAEEGDTTAPESSRTAAGHRKTDSATSSHPPSKRQRPNNDQLSEGPATTDAIEQAQAIDPGEPSDTTEASDHIAERVTRKSSRKATVGQNNGSEDGETGGYPIISKGPAMAPPPIGKLTHPVGYKTNPPPMGRPVRVYADGVFDLFHLGHMRQLEQAKKAFPEVYLLVGVTGDEDTHKRKGLTVLSGKERAETVRHCKWVDEVIEDCPWIVTPEFLEEHKIDYVAHDDIPYGADEGDDIYAPIKAAGKFLVTQRTEGVSTTGIITKIVRDYEKYIARQFKRGASRQELNVSWLKKNELDLKRHIQDLRDNIRSNWATTGQELSKELRQFWPSSRPQSPSPSGFPRLPPQLLAMAQNGGSSADVSNATSPSPLGPASGSAQAGPSNLAPKSPTQAAAQAAGNVNDFITGYTLGLVGGVRSWMSRTRGPSQEDGSRAPSDDDSEEGDKKKSSEKRRSNVPAGSGAASASASTSRAQRRV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.58
2	0.64
3	0.65
4	0.65
5	0.67
6	0.68
7	0.65
8	0.62
9	0.57
10	0.5
11	0.48
12	0.49
13	0.43
14	0.36
15	0.28
16	0.21
17	0.19
18	0.19
19	0.21
20	0.22
21	0.28
22	0.28
23	0.3
24	0.29
25	0.28
26	0.28
27	0.24
28	0.2
29	0.15
30	0.14
31	0.12
32	0.12
33	0.12
34	0.09
35	0.1
36	0.12
37	0.1
38	0.1
39	0.16
40	0.16
41	0.16
42	0.17
43	0.16
44	0.15
45	0.16
46	0.16
47	0.11
48	0.12
49	0.11
50	0.1
51	0.11
52	0.1
53	0.09
54	0.09
55	0.1
56	0.11
57	0.14
58	0.15
59	0.18
60	0.25
61	0.3
62	0.36
63	0.38
64	0.39
65	0.38
66	0.41
67	0.39
68	0.34
69	0.34
70	0.33
71	0.39
72	0.42
73	0.43
74	0.47
75	0.55
76	0.62
77	0.67
78	0.72
79	0.75
80	0.79
81	0.87
82	0.89
83	0.81
84	0.72
85	0.64
86	0.6
87	0.5
88	0.4
89	0.3
90	0.2
91	0.18
92	0.16
93	0.15
94	0.09
95	0.08
96	0.08
97	0.08
98	0.09
99	0.09
100	0.09
101	0.08
102	0.09
103	0.08
104	0.09
105	0.1
106	0.09
107	0.09
108	0.11
109	0.1
110	0.11
111	0.11
112	0.11
113	0.11
114	0.13
115	0.11
116	0.1
117	0.12
118	0.12
119	0.14
120	0.18
121	0.22
122	0.27
123	0.31
124	0.4
125	0.46
126	0.51
127	0.54
128	0.56
129	0.61
130	0.64
131	0.67
132	0.62
133	0.57
134	0.52
135	0.48
136	0.42
137	0.32
138	0.22
139	0.16
140	0.12
141	0.09
142	0.08
143	0.07
144	0.06
145	0.06
146	0.06
147	0.06
148	0.06
149	0.06
150	0.07
151	0.08
152	0.11
153	0.13
154	0.14
155	0.15
156	0.16
157	0.19
158	0.19
159	0.18
160	0.16
161	0.19
162	0.2
163	0.23
164	0.23
165	0.22
166	0.24
167	0.26
168	0.34
169	0.33
170	0.38
171	0.37
172	0.37
173	0.38
174	0.43
175	0.49
176	0.44
177	0.42
178	0.39
179	0.38
180	0.38
181	0.36
182	0.28
183	0.23
184	0.21
185	0.18
186	0.14
187	0.11
188	0.1
189	0.09
190	0.08
191	0.07
192	0.06
193	0.08
194	0.09
195	0.1
196	0.13
197	0.17
198	0.19
199	0.21
200	0.23
201	0.23
202	0.23
203	0.24
204	0.21
205	0.17
206	0.18
207	0.14
208	0.13
209	0.12
210	0.11
211	0.09
212	0.08
213	0.08
214	0.05
215	0.05
216	0.03
217	0.04
218	0.06
219	0.09
220	0.11
221	0.13
222	0.12
223	0.14
224	0.18
225	0.2
226	0.25
227	0.28
228	0.3
229	0.33
230	0.36
231	0.35
232	0.31
233	0.29
234	0.23
235	0.21
236	0.21
237	0.24
238	0.26
239	0.3
240	0.3
241	0.3
242	0.3
243	0.31
244	0.28
245	0.23
246	0.18
247	0.17
248	0.17
249	0.16
250	0.15
251	0.1
252	0.09
253	0.07
254	0.06
255	0.04
256	0.04
257	0.06
258	0.07
259	0.07
260	0.1
261	0.09
262	0.11
263	0.11
264	0.11
265	0.09
266	0.09
267	0.11
268	0.09
269	0.09
270	0.08
271	0.08
272	0.07
273	0.08
274	0.08
275	0.06
276	0.05
277	0.04
278	0.04
279	0.05
280	0.05
281	0.04
282	0.04
283	0.04
284	0.04
285	0.04
286	0.05
287	0.07
288	0.07
289	0.08
290	0.08
291	0.09
292	0.11
293	0.13
294	0.21
295	0.18
296	0.19
297	0.19
298	0.21
299	0.2
300	0.19
301	0.17
302	0.1
303	0.1
304	0.1
305	0.11
306	0.09
307	0.09
308	0.09
309	0.09
310	0.1
311	0.12
312	0.11
313	0.11
314	0.15
315	0.21
316	0.26
317	0.28
318	0.32
319	0.39
320	0.4
321	0.45
322	0.44
323	0.45
324	0.48
325	0.51
326	0.52
327	0.5
328	0.53
329	0.49
330	0.52
331	0.45
332	0.41
333	0.4
334	0.36
335	0.3
336	0.28
337	0.27
338	0.23
339	0.27
340	0.33
341	0.34
342	0.36
343	0.41
344	0.47
345	0.47
346	0.5
347	0.48
348	0.41
349	0.4
350	0.44
351	0.45
352	0.44
353	0.44
354	0.4
355	0.47
356	0.45
357	0.4
358	0.33
359	0.28
360	0.23
361	0.22
362	0.26
363	0.18
364	0.19
365	0.2
366	0.2
367	0.22
368	0.23
369	0.24
370	0.24
371	0.27
372	0.27
373	0.3
374	0.37
375	0.38
376	0.44
377	0.47
378	0.47
379	0.48
380	0.54
381	0.55
382	0.5
383	0.5
384	0.49
385	0.48
386	0.46
387	0.46
388	0.44
389	0.45
390	0.41
391	0.36
392	0.31
393	0.3
394	0.29
395	0.28
396	0.22
397	0.17
398	0.16
399	0.15
400	0.13
401	0.1
402	0.09
403	0.07
404	0.06
405	0.07
406	0.07
407	0.08
408	0.09
409	0.1
410	0.1
411	0.09
412	0.09
413	0.08
414	0.1
415	0.09
416	0.08
417	0.08
418	0.1
419	0.12
420	0.15
421	0.14
422	0.13
423	0.14
424	0.14
425	0.14
426	0.13
427	0.12
428	0.13
429	0.13
430	0.14
431	0.15
432	0.16
433	0.21
434	0.21
435	0.22
436	0.2
437	0.24
438	0.25
439	0.27
440	0.25
441	0.24
442	0.23
443	0.22
444	0.2
445	0.16
446	0.14
447	0.12
448	0.11
449	0.08
450	0.08
451	0.07
452	0.07
453	0.07
454	0.07
455	0.07
456	0.07
457	0.07
458	0.05
459	0.05
460	0.06
461	0.05
462	0.06
463	0.09
464	0.14
465	0.19
466	0.24
467	0.29
468	0.37
469	0.44
470	0.48
471	0.52
472	0.52
473	0.54
474	0.53
475	0.5
476	0.47
477	0.41
478	0.38
479	0.34
480	0.29
481	0.26
482	0.23
483	0.22
484	0.22
485	0.24
486	0.28
487	0.28
488	0.29
489	0.28
490	0.29
491	0.36
492	0.41
493	0.48
494	0.54
495	0.63
496	0.68
497	0.77
498	0.85
499	0.84
500	0.8
501	0.73
502	0.68
503	0.6
504	0.54
505	0.43
506	0.33
507	0.26
508	0.2
509	0.16
510	0.11
511	0.09
512	0.09
513	0.1
514	0.18

G4V1T8

3D AlphaFold-predicted Structure Viewer