Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4V053

Protein Details
Accession G4V053   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-62LVYYSWTKSRRKRRREFEAGVEDHydrophilic
NLS Segment(s)
PositionSequence
49-53RRKRR
Subcellular Location(s) plas 15, mito 3, E.R. 3, cyto 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MELSVFIVSILLFLPMRVSVSAASNTPFLFHLFPWFTVFLVYYSWTKSRRKRRREFEAGVEDVDGIERFTSSIITYLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.09
6 0.08
7 0.1
8 0.12
9 0.11
10 0.12
11 0.12
12 0.12
13 0.12
14 0.12
15 0.11
16 0.11
17 0.1
18 0.14
19 0.14
20 0.15
21 0.16
22 0.15
23 0.14
24 0.13
25 0.13
26 0.09
27 0.08
28 0.09
29 0.08
30 0.09
31 0.13
32 0.17
33 0.24
34 0.33
35 0.44
36 0.53
37 0.63
38 0.72
39 0.78
40 0.85
41 0.87
42 0.84
43 0.81
44 0.79
45 0.69
46 0.59
47 0.49
48 0.38
49 0.28
50 0.24
51 0.15
52 0.07
53 0.06
54 0.05
55 0.05
56 0.06
57 0.07
58 0.06
59 0.09