FuNGI

G4U7N4

Protein Details

Accession

G4U7N4

Localization Confidence

Medium

Confidence Score

10.8

NoLS Segment(s)

Position	Sequence	Protein Nature
17-52	NSRNKMSPSVSKRQQPNRCTDRRPDRREGRKCGSAG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 22, cyto_nucl 13, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR027521 Usb1
Gene Ontology	GO:0005634 C:nucleus GO:0016829 F:lyase activity GO:1990838 F:poly(U)-specific exoribonuclease activity, producing 3' uridine cyclic phosphate ends GO:0034477 P:U6 snRNA 3'-end processing
Pfam	View protein in Pfam PF09749 HVSL

Amino Acid Sequences

MESSGRHCRSFAAYGSNSRNKMSPSVSKRQQPNRCTDRRPDRREGRKCGSAGRSRGYRHVLPRARSCRQVDFTLQNSRRDTEMNEPKPDLSSPLLTQSASYLLSNLCHRAARYVPVMKRPLVDYESGSGSESECGSSSDRPESSSTNIPPQLKRRRNGDIGTRAPPSAPALAPAPTPIAPLDRSSGTHTIPPKPAPKSKSSLPPISDRFNDLYASNTRTAVSDDPSLHQGRQRQVPHIPGNWPSHVYIDWDPSSADRELLSSLVDKLQAEVAAAAQRYPDLEGVKISTALRDPDLPVDKPLHISLSAPITLTPKNKDAFLDDVTRALRSSGVSPFVVDFSGGVDWYRSEESTRSFLVLRVREVQNTGTTADSSPNPRLTTLIQRCNKTVKEYGQPPLYDSQDMGYRFHVTIAWTHARPSESLKQLTDSIFDDCKTMYSENMSIREKLRTGSSFRVETVKVKIGNHVTRFELPDKGLALPVKTT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.43
2	0.52
3	0.57
4	0.53
5	0.5
6	0.5
7	0.44
8	0.46
9	0.44
10	0.45
11	0.46
12	0.55
13	0.61
14	0.66
15	0.74
16	0.79
17	0.82
18	0.79
19	0.81
20	0.81
21	0.82
22	0.81
23	0.81
24	0.82
25	0.83
26	0.85
27	0.85
28	0.85
29	0.87
30	0.9
31	0.89
32	0.86
33	0.82
34	0.76
35	0.73
36	0.72
37	0.69
38	0.66
39	0.63
40	0.62
41	0.57
42	0.63
43	0.61
44	0.58
45	0.57
46	0.62
47	0.62
48	0.62
49	0.69
50	0.71
51	0.69
52	0.71
53	0.68
54	0.66
55	0.63
56	0.61
57	0.57
58	0.54
59	0.54
60	0.57
61	0.57
62	0.54
63	0.52
64	0.49
65	0.44
66	0.39
67	0.38
68	0.37
69	0.44
70	0.44
71	0.46
72	0.46
73	0.45
74	0.45
75	0.42
76	0.34
77	0.26
78	0.23
79	0.2
80	0.23
81	0.24
82	0.22
83	0.21
84	0.18
85	0.17
86	0.15
87	0.14
88	0.11
89	0.1
90	0.12
91	0.14
92	0.15
93	0.15
94	0.16
95	0.16
96	0.19
97	0.21
98	0.23
99	0.28
100	0.34
101	0.36
102	0.42
103	0.46
104	0.43
105	0.42
106	0.4
107	0.38
108	0.32
109	0.3
110	0.23
111	0.22
112	0.22
113	0.21
114	0.2
115	0.15
116	0.13
117	0.13
118	0.12
119	0.09
120	0.08
121	0.09
122	0.11
123	0.13
124	0.14
125	0.18
126	0.18
127	0.19
128	0.21
129	0.22
130	0.24
131	0.29
132	0.28
133	0.3
134	0.35
135	0.37
136	0.4
137	0.48
138	0.55
139	0.56
140	0.59
141	0.59
142	0.61
143	0.63
144	0.63
145	0.63
146	0.61
147	0.58
148	0.57
149	0.52
150	0.44
151	0.38
152	0.34
153	0.27
154	0.2
155	0.15
156	0.13
157	0.12
158	0.13
159	0.13
160	0.13
161	0.13
162	0.1
163	0.11
164	0.1
165	0.1
166	0.1
167	0.12
168	0.13
169	0.12
170	0.14
171	0.17
172	0.19
173	0.18
174	0.21
175	0.24
176	0.26
177	0.29
178	0.32
179	0.34
180	0.37
181	0.43
182	0.43
183	0.44
184	0.44
185	0.46
186	0.51
187	0.51
188	0.51
189	0.47
190	0.5
191	0.48
192	0.48
193	0.43
194	0.37
195	0.32
196	0.27
197	0.26
198	0.19
199	0.19
200	0.17
201	0.19
202	0.17
203	0.16
204	0.15
205	0.15
206	0.16
207	0.14
208	0.14
209	0.14
210	0.14
211	0.14
212	0.18
213	0.19
214	0.17
215	0.19
216	0.22
217	0.23
218	0.29
219	0.3
220	0.3
221	0.32
222	0.38
223	0.39
224	0.37
225	0.35
226	0.33
227	0.35
228	0.32
229	0.3
230	0.24
231	0.21
232	0.19
233	0.2
234	0.15
235	0.16
236	0.15
237	0.14
238	0.14
239	0.13
240	0.16
241	0.12
242	0.12
243	0.08
244	0.08
245	0.08
246	0.08
247	0.08
248	0.06
249	0.07
250	0.07
251	0.08
252	0.07
253	0.07
254	0.08
255	0.07
256	0.06
257	0.06
258	0.06
259	0.07
260	0.07
261	0.07
262	0.06
263	0.06
264	0.06
265	0.07
266	0.09
267	0.07
268	0.08
269	0.08
270	0.09
271	0.1
272	0.11
273	0.1
274	0.09
275	0.09
276	0.1
277	0.11
278	0.1
279	0.11
280	0.15
281	0.18
282	0.18
283	0.19
284	0.2
285	0.2
286	0.2
287	0.2
288	0.16
289	0.13
290	0.13
291	0.13
292	0.13
293	0.13
294	0.11
295	0.12
296	0.13
297	0.16
298	0.19
299	0.2
300	0.22
301	0.22
302	0.23
303	0.23
304	0.23
305	0.23
306	0.23
307	0.24
308	0.2
309	0.22
310	0.22
311	0.21
312	0.18
313	0.15
314	0.13
315	0.1
316	0.12
317	0.12
318	0.14
319	0.14
320	0.14
321	0.15
322	0.14
323	0.13
324	0.1
325	0.08
326	0.06
327	0.07
328	0.06
329	0.06
330	0.06
331	0.06
332	0.08
333	0.1
334	0.09
335	0.1
336	0.12
337	0.15
338	0.18
339	0.18
340	0.18
341	0.17
342	0.2
343	0.25
344	0.26
345	0.26
346	0.3
347	0.3
348	0.3
349	0.31
350	0.31
351	0.25
352	0.24
353	0.22
354	0.16
355	0.16
356	0.15
357	0.16
358	0.17
359	0.19
360	0.22
361	0.25
362	0.25
363	0.24
364	0.25
365	0.26
366	0.34
367	0.39
368	0.44
369	0.46
370	0.49
371	0.51
372	0.57
373	0.55
374	0.5
375	0.49
376	0.44
377	0.48
378	0.5
379	0.55
380	0.53
381	0.51
382	0.48
383	0.46
384	0.43
385	0.35
386	0.29
387	0.24
388	0.23
389	0.24
390	0.23
391	0.2
392	0.2
393	0.2
394	0.2
395	0.19
396	0.15
397	0.17
398	0.22
399	0.27
400	0.24
401	0.25
402	0.28
403	0.28
404	0.28
405	0.33
406	0.35
407	0.36
408	0.39
409	0.39
410	0.38
411	0.4
412	0.4
413	0.35
414	0.27
415	0.25
416	0.23
417	0.22
418	0.2
419	0.17
420	0.18
421	0.19
422	0.18
423	0.15
424	0.18
425	0.23
426	0.27
427	0.33
428	0.35
429	0.35
430	0.36
431	0.4
432	0.36
433	0.33
434	0.35
435	0.33
436	0.36
437	0.42
438	0.45
439	0.42
440	0.43
441	0.46
442	0.41
443	0.4
444	0.41
445	0.4
446	0.38
447	0.36
448	0.42
449	0.47
450	0.53
451	0.53
452	0.5
453	0.47
454	0.48
455	0.53
456	0.48
457	0.43
458	0.36
459	0.36
460	0.34
461	0.31
462	0.3
463	0.28

G4U7N4

3D AlphaFold-predicted Structure Viewer