Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0V2L4

Protein Details
Accession Q0V2L4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKSKRKAVVKSKTPAKHTRBasic
NLS Segment(s)
PositionSequence
5-14KRKAVVKSKT
Subcellular Location(s) mito_nucl 13.333, nucl 12.5, mito 12, cyto_nucl 8.166
Family & Domain DBs
KEGG pno:SNOG_01750  -  
Amino Acid Sequences MPKSKRKAVVKSKTPAKHTRAQPVSTKSKFGPQPVFFCDPDTSTEGGFLSPWYRSPFEYILAEKARIFDDKACLHLSHAWTLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.75
4 0.73
5 0.7
6 0.71
7 0.67
8 0.64
9 0.63
10 0.62
11 0.66
12 0.58
13 0.55
14 0.45
15 0.47
16 0.46
17 0.44
18 0.46
19 0.39
20 0.41
21 0.43
22 0.46
23 0.38
24 0.38
25 0.33
26 0.25
27 0.24
28 0.22
29 0.18
30 0.13
31 0.14
32 0.11
33 0.1
34 0.09
35 0.07
36 0.06
37 0.06
38 0.08
39 0.11
40 0.13
41 0.13
42 0.17
43 0.18
44 0.2
45 0.22
46 0.21
47 0.24
48 0.25
49 0.25
50 0.22
51 0.22
52 0.21
53 0.2
54 0.2
55 0.17
56 0.22
57 0.22
58 0.25
59 0.26
60 0.25
61 0.26
62 0.3
63 0.29