Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UMT6

Protein Details
Accession G4UMT6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
25-49QRSRWERRVGRKGTKGRQRKQKLYDBasic
NLS Segment(s)
PositionSequence
28-45RWERRVGRKGTKGRQRKQ
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MHDFMQRCVPALDSPLSIWQSTVHQRSRWERRVGRKGTKGRQRKQKLYDLFVKVGPICSFWQRSAGRKMRSGGAKMRLCMLASGGPNGLSHPWDHYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.22
4 0.2
5 0.19
6 0.16
7 0.19
8 0.26
9 0.32
10 0.31
11 0.32
12 0.39
13 0.49
14 0.58
15 0.61
16 0.63
17 0.63
18 0.69
19 0.77
20 0.78
21 0.77
22 0.76
23 0.78
24 0.77
25 0.8
26 0.8
27 0.78
28 0.81
29 0.81
30 0.81
31 0.78
32 0.78
33 0.72
34 0.67
35 0.66
36 0.59
37 0.51
38 0.42
39 0.37
40 0.28
41 0.26
42 0.2
43 0.14
44 0.12
45 0.14
46 0.16
47 0.15
48 0.23
49 0.24
50 0.29
51 0.37
52 0.44
53 0.44
54 0.46
55 0.48
56 0.47
57 0.49
58 0.48
59 0.46
60 0.47
61 0.47
62 0.43
63 0.44
64 0.39
65 0.34
66 0.3
67 0.25
68 0.2
69 0.17
70 0.19
71 0.16
72 0.15
73 0.15
74 0.16
75 0.15
76 0.12
77 0.12