Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UL86

Protein Details
Accession G4UL86    Localization Confidence High Confidence Score 21.3
NoLS Segment(s)
PositionSequenceProtein Nature
137-161GASKECSKCKHTRCKQCPRIPSKKTHydrophilic
207-230TQDLVHKKPRQRVRRTCCGCKNLFHydrophilic
NLS Segment(s)
PositionSequence
31-35RTKRL
39-55GAKADPAAPAEKKGKEA
167-173ESRKKRA
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
Amino Acid Sequences MSSATQGGPAVPKEEKKGFGKVLARVKTVLRTKRLSTSGAKADPAAPAEKKGKEAAKSTTKTAPAAAAAAAKTVDANAQKVPRAQLFEERAKKLGELYGLELKPSEWHSTEGHALRVEKPIKMRVHRKCHQCDTSFGASKECSKCKHTRCKQCPRIPSKKTEAEREESRKKRAQIIKDRAENAPIVPDWHPKREKDLVLRRPAKTGTQDLVHKKPRQRVRRTCCGCKNLFTSGNKTCTACQHVRCTDCPRDPSKKDKYPYGYPGDQPSKRQAYFECKACKNTFASEPTVTTCPKCFNRNTERLAPKRVEPQPDPEAWKSIQAKLAAMNLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.41
4 0.47
5 0.45
6 0.49
7 0.51
8 0.52
9 0.57
10 0.55
11 0.53
12 0.48
13 0.48
14 0.49
15 0.52
16 0.52
17 0.5
18 0.51
19 0.52
20 0.58
21 0.59
22 0.55
23 0.52
24 0.51
25 0.52
26 0.49
27 0.46
28 0.39
29 0.37
30 0.35
31 0.32
32 0.29
33 0.21
34 0.24
35 0.3
36 0.3
37 0.31
38 0.35
39 0.38
40 0.37
41 0.41
42 0.44
43 0.48
44 0.49
45 0.5
46 0.5
47 0.47
48 0.44
49 0.4
50 0.33
51 0.24
52 0.22
53 0.18
54 0.14
55 0.12
56 0.12
57 0.11
58 0.09
59 0.08
60 0.08
61 0.11
62 0.1
63 0.12
64 0.15
65 0.17
66 0.19
67 0.22
68 0.25
69 0.24
70 0.27
71 0.27
72 0.31
73 0.35
74 0.43
75 0.47
76 0.46
77 0.45
78 0.41
79 0.4
80 0.33
81 0.29
82 0.22
83 0.16
84 0.17
85 0.23
86 0.23
87 0.23
88 0.21
89 0.19
90 0.19
91 0.21
92 0.2
93 0.13
94 0.16
95 0.17
96 0.19
97 0.25
98 0.24
99 0.23
100 0.22
101 0.22
102 0.21
103 0.28
104 0.27
105 0.24
106 0.25
107 0.31
108 0.35
109 0.41
110 0.49
111 0.51
112 0.6
113 0.65
114 0.72
115 0.72
116 0.75
117 0.75
118 0.66
119 0.6
120 0.57
121 0.57
122 0.52
123 0.44
124 0.37
125 0.31
126 0.35
127 0.37
128 0.33
129 0.29
130 0.3
131 0.38
132 0.46
133 0.56
134 0.59
135 0.66
136 0.73
137 0.82
138 0.86
139 0.85
140 0.86
141 0.85
142 0.86
143 0.79
144 0.75
145 0.71
146 0.69
147 0.64
148 0.63
149 0.57
150 0.52
151 0.54
152 0.56
153 0.58
154 0.54
155 0.57
156 0.54
157 0.52
158 0.55
159 0.55
160 0.57
161 0.58
162 0.63
163 0.65
164 0.65
165 0.65
166 0.56
167 0.51
168 0.42
169 0.31
170 0.23
171 0.15
172 0.13
173 0.12
174 0.19
175 0.2
176 0.28
177 0.31
178 0.29
179 0.36
180 0.4
181 0.42
182 0.44
183 0.52
184 0.53
185 0.6
186 0.66
187 0.61
188 0.58
189 0.55
190 0.49
191 0.42
192 0.38
193 0.3
194 0.28
195 0.33
196 0.36
197 0.43
198 0.48
199 0.49
200 0.51
201 0.57
202 0.63
203 0.67
204 0.72
205 0.75
206 0.75
207 0.81
208 0.83
209 0.85
210 0.83
211 0.81
212 0.73
213 0.67
214 0.62
215 0.57
216 0.56
217 0.48
218 0.47
219 0.44
220 0.46
221 0.42
222 0.39
223 0.34
224 0.33
225 0.37
226 0.36
227 0.36
228 0.4
229 0.45
230 0.47
231 0.5
232 0.53
233 0.54
234 0.54
235 0.55
236 0.54
237 0.58
238 0.6
239 0.65
240 0.68
241 0.68
242 0.67
243 0.69
244 0.69
245 0.67
246 0.69
247 0.68
248 0.61
249 0.56
250 0.61
251 0.61
252 0.57
253 0.53
254 0.54
255 0.54
256 0.5
257 0.5
258 0.46
259 0.46
260 0.5
261 0.54
262 0.54
263 0.5
264 0.57
265 0.56
266 0.55
267 0.48
268 0.46
269 0.44
270 0.39
271 0.4
272 0.35
273 0.35
274 0.35
275 0.36
276 0.33
277 0.29
278 0.27
279 0.31
280 0.34
281 0.4
282 0.42
283 0.49
284 0.57
285 0.64
286 0.68
287 0.7
288 0.75
289 0.74
290 0.76
291 0.69
292 0.64
293 0.65
294 0.65
295 0.63
296 0.56
297 0.58
298 0.57
299 0.59
300 0.61
301 0.54
302 0.52
303 0.44
304 0.5
305 0.45
306 0.43
307 0.42
308 0.36
309 0.35
310 0.33