Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4U6Y6

Protein Details
Accession G4U6Y6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-102RVQWRRSVDIHRRRKEGRKEGSWBasic
NLS Segment(s)
PositionSequence
91-98RRRKEGRK
Subcellular Location(s) nucl 17, cyto_nucl 11.5, cyto 4, cysk 4
Family & Domain DBs
Amino Acid Sequences MRHETMYPRPSDEETKAPGVSSDGHEELAMCGAQEHSGIVRCIDGGRESIIGFHSPQGPRLQVRMQGPCSLHFHSVVVIRVQWRRSVDIHRRRKEGRKEGSWHWAAEALIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.36
4 0.32
5 0.28
6 0.24
7 0.22
8 0.19
9 0.2
10 0.17
11 0.17
12 0.17
13 0.17
14 0.15
15 0.14
16 0.11
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.05
23 0.05
24 0.08
25 0.08
26 0.08
27 0.07
28 0.08
29 0.08
30 0.08
31 0.08
32 0.06
33 0.07
34 0.08
35 0.07
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.12
42 0.12
43 0.14
44 0.15
45 0.16
46 0.16
47 0.19
48 0.19
49 0.2
50 0.23
51 0.27
52 0.27
53 0.29
54 0.29
55 0.29
56 0.32
57 0.29
58 0.26
59 0.22
60 0.2
61 0.18
62 0.2
63 0.18
64 0.15
65 0.14
66 0.17
67 0.2
68 0.21
69 0.24
70 0.23
71 0.25
72 0.28
73 0.37
74 0.44
75 0.51
76 0.61
77 0.64
78 0.69
79 0.74
80 0.8
81 0.81
82 0.81
83 0.8
84 0.78
85 0.77
86 0.75
87 0.78
88 0.71
89 0.6
90 0.51
91 0.44