Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4UYA4

Protein Details
Accession G4UYA4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-43PGPPRFPKFPPKPQNKAGEHBasic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 1.5, cyto_pero 1.5
Family & Domain DBs
Amino Acid Sequences MLRVGEMLRHSVFLHRPRSILPLPGPPRFPKFPPKPQNKAGEHVFIRLVTSAPRHPFICVGTIHDLSRLIYQACATLVRSTYLGMKKGDRKRSRQWASNTGATVRAKVRQITRTSVRVWLHNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.37
4 0.37
5 0.44
6 0.4
7 0.39
8 0.35
9 0.38
10 0.41
11 0.45
12 0.47
13 0.44
14 0.48
15 0.47
16 0.48
17 0.48
18 0.52
19 0.59
20 0.65
21 0.71
22 0.72
23 0.75
24 0.81
25 0.73
26 0.7
27 0.62
28 0.59
29 0.49
30 0.43
31 0.37
32 0.27
33 0.24
34 0.18
35 0.15
36 0.09
37 0.11
38 0.14
39 0.15
40 0.18
41 0.17
42 0.18
43 0.19
44 0.18
45 0.18
46 0.14
47 0.15
48 0.16
49 0.16
50 0.16
51 0.15
52 0.15
53 0.13
54 0.13
55 0.11
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.08
65 0.09
66 0.09
67 0.09
68 0.15
69 0.17
70 0.19
71 0.2
72 0.25
73 0.33
74 0.42
75 0.52
76 0.54
77 0.59
78 0.66
79 0.75
80 0.78
81 0.77
82 0.76
83 0.75
84 0.73
85 0.7
86 0.62
87 0.52
88 0.5
89 0.42
90 0.38
91 0.31
92 0.3
93 0.29
94 0.33
95 0.38
96 0.4
97 0.43
98 0.48
99 0.52
100 0.52
101 0.51
102 0.54
103 0.5