Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UBT0

Protein Details
Accession G4UBT0   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MRRSSVRRWRSRRRSRLSSVAKRERVGHydrophilic
94-119ANLGPRNLGRRRKKIKMGKDRICASLHydrophilic
NLS Segment(s)
PositionSequence
6-25VRRWRSRRRSRLSSVAKRER
99-112RNLGRRRKKIKMGK
Subcellular Location(s) mito 18.5, mito_nucl 12, nucl 4.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MRRSSVRRWRSRRRSRLSSVAKRERVGEVVALSGRLKLKLKPQRRDAVTVAVWTVRSDRREVKREDEEKRPAPLDAKRGYRQCSTFPLEAKNEANLGPRNLGRRRKKIKMGKDRICASLVWDGKGQQASN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.88
3 0.89
4 0.88
5 0.88
6 0.87
7 0.86
8 0.81
9 0.72
10 0.67
11 0.58
12 0.49
13 0.4
14 0.3
15 0.2
16 0.18
17 0.17
18 0.15
19 0.13
20 0.13
21 0.13
22 0.14
23 0.15
24 0.16
25 0.26
26 0.35
27 0.45
28 0.51
29 0.58
30 0.65
31 0.66
32 0.69
33 0.6
34 0.57
35 0.47
36 0.39
37 0.32
38 0.23
39 0.2
40 0.15
41 0.16
42 0.13
43 0.13
44 0.16
45 0.23
46 0.3
47 0.36
48 0.39
49 0.42
50 0.48
51 0.53
52 0.55
53 0.54
54 0.54
55 0.5
56 0.5
57 0.44
58 0.35
59 0.33
60 0.32
61 0.31
62 0.3
63 0.34
64 0.37
65 0.4
66 0.44
67 0.44
68 0.43
69 0.39
70 0.39
71 0.39
72 0.36
73 0.34
74 0.35
75 0.33
76 0.34
77 0.32
78 0.27
79 0.23
80 0.2
81 0.23
82 0.21
83 0.21
84 0.2
85 0.22
86 0.28
87 0.35
88 0.45
89 0.5
90 0.58
91 0.66
92 0.72
93 0.8
94 0.83
95 0.86
96 0.87
97 0.89
98 0.87
99 0.87
100 0.81
101 0.74
102 0.65
103 0.54
104 0.46
105 0.44
106 0.36
107 0.29
108 0.27
109 0.25
110 0.28